GHBP Rabbit

Growth Hormone Binding Protein Rabbit Recombinant
Cat. No.
BT15118
Source
Escherichia Coli.
Synonyms
GHR, GHBP, GH receptor, Somatotropin receptor.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 98.0% as determined bySDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Growth Hormone Binding Protein Rabbit Extracellular Domain Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 249 amino acids and having a molecular mass of 28 kDa. GHBP Rabbit is purified by proprietary chromatographic techniques.

Product Specs

Introduction
The growth hormone receptor (GHR) is a transmembrane protein that binds to growth hormone (GH). This binding triggers the dimerization of the receptor, initiating both internal and external signal transduction pathways that ultimately lead to growth. A well-studied alternate form of the GHR gene, known as GHRd3, lacks exon three. Mutations in this gene are linked to Laron syndrome, also called growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. While other variations, such as one encoding a soluble form of the protein (GHRtr), have been identified, they haven't been fully investigated.
Description
Recombinant Growth Hormone Binding Protein (GHBP) Rabbit Extracellular Domain, produced in E. coli, is a single, non-glycosylated polypeptide chain. This protein comprises 249 amino acids, resulting in a molecular weight of 28 kDa. The purification of GHBP Rabbit is achieved through proprietary chromatographic methods.
Physical Appearance
Sterile Filtered White Lyophilized Powder
Formulation
The Growth Hormone Binding Protein Rabbit was lyophilized from a 1 mg/ml solution containing 0.0045 mM NaHCO3.
Solubility
For reconstitution, it is advised to dissolve the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 at a pH of 10, to a minimum concentration of 100 µg/ml. This solution can then be diluted further into other aqueous solutions as needed.
Stability
Lyophilized Growth Hormone Binding Protein Rabbit exhibits stability at room temperature for up to 3 weeks. However, it is recommended to store it desiccated below -18°C. Once reconstituted, GHBP Rabbit should be stored at 4°C for a period of 2-7 days. For long-term storage, freezing below -18°C is advised. To enhance stability during prolonged storage, consider adding a carrier protein such as 0.1% HSA or BSA. It's important to minimize freeze-thaw cycles.
Purity
Purity exceeding 98.0% as determined by SDS-PAGE analysis.
Biological Activity
The biological activity of this product is confirmed by its ability to form a 2:1 complex with non-primate Growth Hormones.
Synonyms
GHR, GHBP, GH receptor, Somatotropin receptor.
Source
Escherichia Coli.
Amino Acid Sequence

AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLK
SPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVD
QKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYK
EVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP.

Product Science Overview

Introduction

Growth Hormone Binding Protein (GHBP) is a crucial component in the regulation of growth hormone (GH) activity. The recombinant form of GHBP, specifically derived from rabbits, has been extensively studied for its unique properties and applications in research and medicine.

Background and Structure

Growth Hormone Binding Protein Rabbit Recombinant is produced in Escherichia coli (E. coli) and is a single, non-glycosylated polypeptide chain. It contains 248 amino acids and has a molecular mass of approximately 48 kDa . The sequence of the first five N-terminal amino acids is Ala-Phe-Ser-Gly-Ser .

Production and Purification

The recombinant GHBP is expressed in E. coli and purified using proprietary chromatographic techniques to ensure high purity. The purity of the protein is greater than 98.0%, as determined by Size-Exclusion Chromatography (SEC-HPLC) and Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) .

Formulation and Storage

GHBP Rabbit Recombinant is typically lyophilized from a concentrated solution with 0.0045mM NaHCO3. The lyophilized form is a sterile, filtered white powder . For storage, it is recommended to keep the lyophilized protein desiccated below -18°C. Upon reconstitution, it should be stored at 4°C for short-term use (2-7 days) and below -18°C for long-term storage. To prevent freeze-thaw cycles, adding a carrier protein such as 0.1% Human Serum Albumin (HSA) or Bovine Serum Albumin (BSA) is advisable .

Biological Activity

The biological activity of GHBP is evidenced by its ability to form a 2:1 complex with non-primate growth hormones . This interaction is crucial for modulating the availability and activity of growth hormones in the body.

Applications

Recombinant GHBP is widely used in research to study the mechanisms of growth hormone action and regulation. It is also employed in various assays to measure growth hormone levels and activity. Additionally, GHBP can be used in therapeutic applications to modulate growth hormone activity in clinical settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.