Growth Hormone Binding Protein Rabbit Extracellular Domain Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 249 amino acids and having a molecular mass of 28 kDa. GHBP Rabbit is purified by proprietary chromatographic techniques.
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLK
SPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVD
QKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYK
EVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP.
Growth Hormone Binding Protein (GHBP) is a crucial component in the regulation of growth hormone (GH) activity. The recombinant form of GHBP, specifically derived from rabbits, has been extensively studied for its unique properties and applications in research and medicine.
Growth Hormone Binding Protein Rabbit Recombinant is produced in Escherichia coli (E. coli) and is a single, non-glycosylated polypeptide chain. It contains 248 amino acids and has a molecular mass of approximately 48 kDa . The sequence of the first five N-terminal amino acids is Ala-Phe-Ser-Gly-Ser .
The recombinant GHBP is expressed in E. coli and purified using proprietary chromatographic techniques to ensure high purity. The purity of the protein is greater than 98.0%, as determined by Size-Exclusion Chromatography (SEC-HPLC) and Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) .
GHBP Rabbit Recombinant is typically lyophilized from a concentrated solution with 0.0045mM NaHCO3. The lyophilized form is a sterile, filtered white powder . For storage, it is recommended to keep the lyophilized protein desiccated below -18°C. Upon reconstitution, it should be stored at 4°C for short-term use (2-7 days) and below -18°C for long-term storage. To prevent freeze-thaw cycles, adding a carrier protein such as 0.1% Human Serum Albumin (HSA) or Bovine Serum Albumin (BSA) is advisable .
Recombinant GHBP is widely used in research to study the mechanisms of growth hormone action and regulation. It is also employed in various assays to measure growth hormone levels and activity. Additionally, GHBP can be used in therapeutic applications to modulate growth hormone activity in clinical settings.