FGFR2 Human

Fibroblast Growth Factor Receptor 2 Fc Chimera Human Recombinant
Cat. No.
BT19477
Source
Insect Cells.
Synonyms
Keratinocyte growth factor receptor 2, CD332, FGFR2.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity

Greater than 90.0% as determined by SDS-PAGE.

Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

Soluble FGFR-2a (IIIc) Fc Chimera Human Recombinant fused with Xa cleavage site with the Fc part of human IgG1 produced in baculovirus is a heterodimeric, glycosylated, Polypeptide chain containing 602 amino acids and having a molecular mass of 170 kDa.
The FGFR2 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
The Fibroblast Growth Factor (FGF) family consists of at least 18 structurally similar proteins with diverse roles in physiological and pathological cellular processes. These processes include cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. FGFs exert their biological activities by binding to and activating type I transmembrane tyrosine kinase receptors known as FGF receptors (FGFRs). Activation leads to receptor dimerization and autophosphorylation. Currently, four distinct genes encoding highly similar FGFRs (FGFR-1 to -4) have been identified. Alternative splicing of mRNAs from FGFR-1 to -3 genes generates multiple receptor isoforms. A common splicing event affects FGFR-1 and -2, resulting in two isoforms: the alpha isoform, containing all three immunoglobulin-like domains (IgI, IgII, and IgIII), and the beta isoform, containing only IgII and IgIII. In contrast, FGFR-3 and FGFR-4 have only been observed as the alpha isoform. Further splicing events for FGFR-1 to -3 occur in the C-terminal half of the IgIII domain. These events involve two mutually exclusive alternative exons, leading to FGF receptors with distinct IgIII domains (IIIb and IIIc). Additionally, a secreted FGF-binding protein called the IIIa isoform has been described for FGFR-1. This isoform consists of the N-terminal half of the IgIII domain and some intronic sequences. Mutations in FGFR-1 to -3 have been linked to birth defects characterized by craniosynostosis.
Description
Soluble FGFR-2a (IIIc) Fc Chimera Human Recombinant is a heterodimeric, glycosylated polypeptide chain with a molecular weight of 170 kDa. It comprises 602 amino acids and includes a Xa cleavage site fused with the Fc region of human IgG1. The protein is produced in a baculovirus expression system and purified using proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
CD332 was lyophilized from a sterile solution with a concentration of 1 mg/ml. The solution does not contain any additives.
Solubility
To reconstitute the lyophilized FGFR-2, it is recommended to dissolve it in sterile PBS at a concentration of at least 100 µg/ml. This solution can then be further diluted in other aqueous solutions.
Stability
Lyophilized FGFR2A remains stable at room temperature for up to 3 weeks. However, it is recommended to store it desiccated below -18°C for long-term storage. Once reconstituted, FGFR2 should be stored at 4°C for 2-7 days. For future use, it can be stored below -18°C. To ensure long-term stability during storage, it is advisable to add a carrier protein like HSA or BSA at a concentration of 0.1%. Avoid repeated freeze-thaw cycles.
Purity
The purity of the protein is determined by SDS-PAGE analysis and is greater than 90.0%.
Biological Activity
The biological activity of the protein is assessed based on its ability to inhibit human FGF-2-dependent proliferation in HUVE cells. The ED50 for this effect is typically in the range of 15 - 30 ng/ml.
Synonyms
Keratinocyte growth factor receptor 2, CD332, FGFR2.
Source
Insect Cells.
Amino Acid Sequence

RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWT KDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVT DAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKF RCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNY TCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVT FEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEDPRRASIE GRGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK

10x Buffer With Mgso4
default

Product Science Overview

Structure and Isoforms

FGFR2 exists in multiple isoforms due to alternative splicing of its mRNA. The two main isoforms are FGFR2 alpha (IIIb) and FGFR2 beta (IIIc), which differ in their ligand-binding specificities and tissue distribution . The alpha isoform contains all three immunoglobulin (Ig) domains, while the beta isoform contains only IgII and IgIII domains .

FGFR2 Fc Chimera

The FGFR2 Fc Chimera is a recombinant fusion protein that combines the extracellular domain of FGFR2 with the Fc region of human IgG1 . This fusion enhances the stability and solubility of the receptor, making it suitable for various research applications. The Fc region also allows for easy purification using protein A or G affinity chromatography .

Production and Purification

The FGFR2 Fc Chimera is typically produced in insect cells using a baculovirus expression system . The recombinant protein is then purified using proprietary chromatographic techniques to achieve high purity levels (>90%) as determined by SDS-PAGE . The lyophilized protein is stable at room temperature for several weeks but should be stored at -18°C for long-term storage .

Biological Activity

The biological activity of the FGFR2 Fc Chimera is determined by its ability to inhibit FGF-dependent proliferation of various cell types . For example, it has been shown to inhibit the proliferation of NR6R-3T3 mouse fibroblast cells and human umbilical vein endothelial (HUVE) cells . The effective dose (ED50) for these effects is typically in the range of 1-30 ng/mL .

Applications

The FGFR2 Fc Chimera is widely used in research to study the mechanisms of FGF signaling and its role in various physiological and pathological processes . It is also used in drug discovery and development to screen for potential inhibitors of FGFR2 signaling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

FGFR1 Human
Fibroblast Growth Factor Receptor 1 Fc Chimera Human Recombinant
Cat. No.
BT18986
Source
Insect Cells.
FGFR2 Human, His
Fibroblast Growth Factor Receptor-2 Human Recombinant, His Tag
Cat. No.
BT19635
Source
Sf9, Baculovirus cells.
FGFR3 Human
Fibroblast Growth Factor Receptor 3 Fc Chimera Human Recombinant
Cat. No.
BT19772
Source
Insect Cells.
FGFR4 Human
Fibroblast Growth Factor Receptor 4 Fc Chimera Human Recombinant
Cat. No.
BT19861
Source
Insect Cells.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.