FGFR1 Human

Fibroblast Growth Factor Receptor 1 Fc Chimera Human Recombinant
Cat. No.
BT18986
Source
Insect Cells.
Synonyms
FGFR-1, bFGF-R, C-FGR, CD331, fms-related tyrosine kinase 2, Pfeiffer syndrome, CEK, FLG, FLT2, KAL2, BFGFR, FGFBR, HBGFR, FGFR1/FGFR1OP2 FUSION GENE, FGFR1/ZNF198 FUSION GENE, FLG FGFR1/BCR FUSION GENE, FLG protein, FMS-LIKE GENE, N-sam tyrosine kinase, basic fibroblast growth factor receptor 1.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 90.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

Soluble FGFR-1a (IIIc) Fc Chimera Human Recombinant fused with Xa cleavage site with the Fc part of human IgG1 produced in baculovirus is a heterodimeric, glycosylated, Polypeptide chain containing 601 amino acids and having a molecular mass of 170 kDa. The FGFR1 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
The Fibroblast Growth Factor (FGF) family consists of at least 18 structurally related proteins involved in various physiological and pathological processes. These processes include cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. FGFs exert their biological effects by binding to and activating type I transmembrane tyrosine kinase receptors. Upon ligand binding, these receptors dimerize and autophosphorylate. Four distinct genes encode closely related FGF receptors: FGFR-1, -2, -3, and -4. Alternative splicing of mRNAs generates multiple forms of FGFR-1 to -3. A common splicing event in FGFR-1 and -2 produces receptors containing all three immunoglobulin-like domains (Ig domains) termed the alpha isoform. Alternatively, receptors containing only IgII and IgIII are termed the beta isoform. Only the alpha isoform has been identified for FGFR-3 and FGFR-4. Further splicing events for FGFR-1 to -3 involve the C-terminal half of the IgIII domain. These events result in FGF receptors with alternative IgIII domains (IIIb and IIIc) generated by two mutually exclusive alternative exons. A secreted FGF binding protein, the IIIa isoform, containing only the N-terminal half of the IgIII domain and some intron sequences, has also been reported for FGFR-1. Notably, mutations in FGFR-1 to -3 have been identified in patients with birth defects involving craniosynostosis.
Description
Soluble FGFR-1a (IIIc) Fc Chimera Human Recombinant, incorporating a Xa cleavage site and the Fc domain of human IgG1, is produced in a baculovirus expression system. This chimeric protein is a heterodimeric, glycosylated polypeptide chain comprising 601 amino acids with a molecular weight of 170 kDa. The purification of FGFR1 is achieved using proprietary chromatographic methods.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
CD331 was lyophilized from a sterile solution at a concentration of 1 mg/ml in 1xPBS.
Solubility
To reconstitute the lyophilized bFGF-R, it is recommended to dissolve it in sterile PBS at a minimum concentration of 100 µg/ml. The reconstituted solution can be further diluted in other aqueous solutions as needed.
Stability
Lyophilized FGFR1A can be stored at room temperature for up to 3 weeks; however, for extended storage, it is recommended to store it desiccated at a temperature below -18°C. After reconstitution, FGFR1 should be stored at 4°C for a period of 2-7 days. For long-term storage, it is advisable to store it below -18°C. To ensure optimal stability during long-term storage, the addition of a carrier protein (0.1% HSA or BSA) is recommended. Repeated freeze-thaw cycles should be avoided.
Purity
The purity of this product is greater than 90.0% as determined by SDS-PAGE analysis.
Biological Activity
The biological activity of this product is determined based on its ability to inhibit human FGF acidic-dependent proliferation in R1 cells. The ED50 for this inhibitory effect is typically in the range of 15.0-30.0 ng/ml.
Synonyms
FGFR-1, bFGF-R, C-FGR, CD331, fms-related tyrosine kinase 2, Pfeiffer syndrome, CEK, FLG, FLT2, KAL2, BFGFR, FGFBR, HBGFR, FGFR1/FGFR1OP2 FUSION GENE, FGFR1/ZNF198 FUSION GENE, FLG FGFR1/BCR FUSION GENE, FLG protein, FMS-LIKE GENE, N-sam tyrosine kinase, basic fibroblast growth factor receptor 1.
Source
Insect Cells.
Amino Acid Sequence

RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQL AESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSS EDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFK CPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYT CIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYS DPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSF EDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEDPRRASIEG RGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK

Product Science Overview

Introduction

Fibroblast Growth Factor Receptor 1 (FGFR1) is a crucial member of the fibroblast growth factor receptor family, which plays a significant role in various cellular processes, including cell growth, differentiation, angiogenesis, and wound healing . The FGFR1 Fc Chimera is a recombinant protein that combines the extracellular domain of FGFR1 with the Fc region of human immunoglobulin G (IgG), enhancing its stability and functionality .

Structure and Function

FGFR1 consists of an extracellular region with three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment, and a cytoplasmic tyrosine kinase domain . The extracellular portion interacts with fibroblast growth factors (FGFs), initiating a cascade of downstream signals that influence mitogenesis and differentiation .

The Fc Chimera variant of FGFR1 is engineered to include the Fc region of human IgG, which provides several advantages:

  • Increased Stability: The Fc region enhances the stability of the recombinant protein, making it more suitable for various applications .
  • Improved Purification: The Fc region allows for easier purification using protein A or G affinity chromatography .
  • Enhanced Biological Activity: The Fc Chimera can inhibit FGF-dependent proliferation of cells, making it useful in research and therapeutic applications .
Applications

The FGFR1 Fc Chimera has several applications in biomedical research and therapeutic development:

  • Cancer Research: FGFR1 is implicated in various cancers, and the Fc Chimera can be used to study its role in tumorigenesis and as a potential therapeutic target .
  • Developmental Biology: FGFR1 is involved in limb induction and other developmental processes, making the Fc Chimera a valuable tool for studying these pathways .
  • Drug Development: The Fc Chimera can be used in high-throughput screening assays to identify potential inhibitors of FGFR1 signaling .
Production and Purification

The recombinant FGFR1 Fc Chimera is typically produced in mammalian cell lines, such as NS0 or CHO cells, to ensure proper folding and post-translational modifications . The protein is purified using affinity chromatography, and its purity is assessed by SDS-PAGE and other analytical techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

FGFR1 Human, (22-285)
Fibroblast Growth Factor Receptor-1 Human Recombinant, (22-285 a.a.)
Cat. No.
BT19070
Source
<p>Sf9, Baculovirus cells. </p>
FGFR1 Human, (22-374)
Fibroblast Growth Factor Receptor-1, (22-374 a.a.) Human Recombinant
Cat. No.
BT19160
Source
Insect Cells.
FGFR1 Human, His
Fibroblast Growth Factor Receptor-1 Human Recombinant, His Tag
Cat. No.
BT19265
Source
<p>Sf9, Baculovirus cells. </p>
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.