Eotaxin 2 Human

Eotaxin-2 Human Recombinant (CCL24)
Cat. No.
BT11160
Source
Escherichia Coli.
Synonyms
C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage

THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Shipped with Ice Packs
In Stock

Description

CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa.
The CCL24 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Eotaxin-2, also known as MPIF2 and Ckb6, is a CC chemokine primarily produced by activated monocytes and T lymphocytes. It exhibits selective chemoattraction towards cells expressing the CCR3 receptor, encompassing eosinophils, basophils, Th2 T cells, mast cells, and specific dendritic cell subsets. Moreover, Eotaxin-2 demonstrates an inhibitory effect on the proliferation of multipotential hematopoietic progenitor cells. The mature protein, often subject to C-terminal truncation, comprises 78 amino acids in its human form and 92 amino acids in its murine counterpart (prior to truncation). Notably, CCL24, a related chemokine, shares functional similarities with Eotaxin-2, acting as a chemoattractant for resting T lymphocytes and eosinophils, albeit with weaker activity on neutrophils and no effect on monocytes or activated lymphocytes. Similar to Eotaxin-2, CCL24 exhibits suppressive effects on colony formation in a multipotential hematopoietic progenitor cell line, binding to the CCR3 receptor.
Description
Recombinant human CCL24, produced in E. coli, is a single, non-glycosylated polypeptide chain composed of 78 amino acids, resulting in a molecular weight of 8.8 kDa. The purification process employs proprietary chromatographic techniques to ensure high purity.
Physical Appearance
Sterile white lyophilized powder.
Formulation
The lyophilized CCL24 protein is prepared in a sterile solution containing 20mM PBS (pH 7.4) and 0.15M sodium chloride at a concentration of 1 mg/mL.
Solubility
To reconstitute the lyophilized CCL24, it is recommended to dissolve it in sterile 18 MΩ-cm H2O at a minimum concentration of 100 µg/mL. Further dilutions can be made using other aqueous solutions.
Stability
Lyophilized Eotaxin-2 exhibits stability at room temperature for up to 3 weeks; however, for long-term storage, it is recommended to store it in a desiccated state below -18°C. After reconstitution, CCL24 remains stable at 4°C for 2-7 days. For extended storage periods, freezing below -18°C is advisable, and the addition of a carrier protein like HSA or BSA (0.1%) is recommended. Avoid repeated freeze-thaw cycles.
Purity
The purity of CCL24 exceeds 97.0%, as determined by reverse-phase high-performance liquid chromatography (RP-HPLC) and sodium dodecyl-sulfate polyacrylamide gel electrophoresis (SDS-PAGE).
Biological Activity
The biological activity of CCL24 is evaluated based on its chemotactic effect on human peripheral blood eosinophils (PBE). A concentration range of 50-100 ng/mL induces chemotaxis, corresponding to a specific activity of 10,000-20,000 IU/mg.
Synonyms
C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
Source
Escherichia Coli.
Amino Acid Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCG
DPKQEWV QRYMKNLDAKQKKASPRARAVA.

Product Science Overview

Discovery and Cloning

CCL24 was initially cloned from a library of activated macrophages. It was shown that CCL24 binds to the receptor of eotaxin-1 (CCL11) and MCP-4 (CCL13). Additionally, CCL24 shares the CCR3 receptor with CCL26, CCL5, and CCL7 .

Structure and Expression

The human CCL24 protein consists of 93 amino acids with a predicted molecular mass of approximately 10.4 kDa. When expressed in E. coli, the DTT-reduced protein migrates at approximately 12 kDa and the non-reduced protein migrates at 14 kDa by SDS-PAGE . CCL24 is constitutively expressed in the jejunum and spleen and can be induced in the lung by allergen challenge and IL-4 .

Function and Bioactivity

CCL24 is known for its chemotactic properties, particularly for eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells . It has lower chemotactic activity for neutrophils and none for monocytes and activated lymphocytes . CCL24 is a strong suppressor of colony formation by multipotential hematopoietic progenitor cell lines .

Role in Disease

The eotaxin/CCR3 axis, which includes CCL24, has been extensively studied in the pathogenesis of asthma and allergy. It has also been associated with additional inflammatory and autoimmune disorders, including inflammatory bowel disease, multiple sclerosis, eosinophilic esophagitis, and rheumatoid arthritis . Furthermore, CCL24 has been linked to neovascular age-related macular degeneration .

Recombinant Production

Recombinant human CCL24 is produced in various expression systems, including E. coli and HEK293 cells. The recombinant protein is often purified to high levels of purity (>95%) and is used in research to study its biological functions and potential therapeutic applications .

Storage and Handling

Recombinant CCL24 can be stored at -20°C for up to six months or at -70°C or colder until the expiration date. For maximum results, it is recommended to quick spin the vial prior to opening and avoid repeated freeze/thaw cycles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.