Introduction
Eotaxin-2, also known as MPIF2 and Ckb6, is a CC chemokine primarily produced by activated monocytes and T lymphocytes. It exhibits selective chemoattraction towards cells expressing the CCR3 receptor, encompassing eosinophils, basophils, Th2 T cells, mast cells, and specific dendritic cell subsets. Moreover, Eotaxin-2 demonstrates an inhibitory effect on the proliferation of multipotential hematopoietic progenitor cells. The mature protein, often subject to C-terminal truncation, comprises 78 amino acids in its human form and 92 amino acids in its murine counterpart (prior to truncation). Notably, CCL24, a related chemokine, shares functional similarities with Eotaxin-2, acting as a chemoattractant for resting T lymphocytes and eosinophils, albeit with weaker activity on neutrophils and no effect on monocytes or activated lymphocytes. Similar to Eotaxin-2, CCL24 exhibits suppressive effects on colony formation in a multipotential hematopoietic progenitor cell line, binding to the CCR3 receptor.
Description
Recombinant human CCL24, produced in E. coli, is a single, non-glycosylated polypeptide chain composed of 78 amino acids, resulting in a molecular weight of 8.8 kDa. The purification process employs proprietary chromatographic techniques to ensure high purity.
Physical Appearance
Sterile white lyophilized powder.
Formulation
The lyophilized CCL24 protein is prepared in a sterile solution containing 20mM PBS (pH 7.4) and 0.15M sodium chloride at a concentration of 1 mg/mL.
Solubility
To reconstitute the lyophilized CCL24, it is recommended to dissolve it in sterile 18 MΩ-cm H2O at a minimum concentration of 100 µg/mL. Further dilutions can be made using other aqueous solutions.
Stability
Lyophilized Eotaxin-2 exhibits stability at room temperature for up to 3 weeks; however, for long-term storage, it is recommended to store it in a desiccated state below -18°C. After reconstitution, CCL24 remains stable at 4°C for 2-7 days. For extended storage periods, freezing below -18°C is advisable, and the addition of a carrier protein like HSA or BSA (0.1%) is recommended. Avoid repeated freeze-thaw cycles.
Purity
The purity of CCL24 exceeds 97.0%, as determined by reverse-phase high-performance liquid chromatography (RP-HPLC) and sodium dodecyl-sulfate polyacrylamide gel electrophoresis (SDS-PAGE).
Biological Activity
The biological activity of CCL24 is evaluated based on its chemotactic effect on human peripheral blood eosinophils (PBE). A concentration range of 50-100 ng/mL induces chemotaxis, corresponding to a specific activity of 10,000-20,000 IU/mg.
Synonyms
C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
Amino Acid Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCG
DPKQEWV QRYMKNLDAKQKKASPRARAVA.