BMP 7 Human, Plant
Description
The BMP-7 is purified by proprietary chromatographic techniques.
Product Specs
SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY
YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP
CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Product Science Overview
Bone Morphogenetic Protein-7 (BMP-7), also known as osteogenic protein-1 (OP-1), is a member of the transforming growth factor-beta (TGF-β) superfamily. This protein plays a crucial role in the development and repair of bone and cartilage. BMP-7 is encoded by the BMP7 gene in humans and is involved in various biological processes, including embryogenesis, hematopoiesis, neurogenesis, and skeletal morphogenesis .
Human recombinant BMP-7 produced in plants is a monomeric, glycosylated polypeptide chain containing 144 amino acids and has a molecular mass of 16.5 kDa. It is fused to a 6xHis-tag at the N-terminus and is purified using proprietary chromatographic techniques . The recombinant production of BMP-7 in plants offers a cost-effective and scalable method for generating this protein, which is essential for therapeutic applications.
BMP-7 functions by initiating the canonical BMP signaling cascade. It associates with type I receptor ACVR1 and type II receptor ACVR2A at the cell surface. Once all three components are bound together in a complex, ACVR2A phosphorylates and activates ACVR1. This activation propagates the signal by phosphorylating SMAD1/5/8, which then travel to the nucleus and act as activators and repressors of transcription of target genes .
- Bone and Cartilage Formation: BMP-7 plays a key role in the transformation of mesenchymal cells into bone and cartilage. It induces the phosphorylation of SMAD1 and SMAD5, which in turn induce the transcription of numerous osteogenic genes .
- Kidney Development and Homeostasis: BMP-7 is involved in mammalian kidney development through the induction of mesenchymal-to-epithelial transition (MET) of the metanephrogenic blastema. It also plays a role in maintaining kidney homeostasis by inhibiting epithelial-mesenchymal transition (EMT), which can lead to fibrosis and renal failure .
- Embryonic Development: BMP-7 is crucial in the determination of ventral-dorsal organization in vertebrates. It causes the expression of ventral phenotypes, while its inhibition creates a dorsal phenotype .
Human recombinant BMP-7 has significant therapeutic potential, particularly in the field of orthopedics. It is a potent bone-inducing agent and can be used in the treatment of bone defects when combined with an appropriate osteoconductive carrier, such as a collagen sponge or synthetic hydroxyapatite . BMP-7 has been used in surgical procedures to promote bone healing and regeneration.
