VCAM1 Human, HEK
Description
Product Specs
TLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKP
ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIE
DIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVT
MTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEV
ELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTN
STLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSSVTVSCKV
PSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID
DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGE
LQPLSENATLTLISTKMEDSGVYLCEGINQIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRE
NNKDYFSPEVDHHHHHHAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPETW
IILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPE
VDHHHHHH.
Product Science Overview
VCAM-1 is a member of the immunoglobulin superfamily, which includes antibodies and T-cell receptors . The gene encoding VCAM-1, known as VCAM1, contains six or seven immunoglobulin domains . This protein is expressed on both large and small blood vessels, but only after the endothelial cells are stimulated by cytokines .
The human recombinant form of VCAM-1 produced in HEK cells is a single polypeptide chain containing 682 amino acids, with an additional 8 amino acid His-tag at the C-terminus . This recombinant form is used extensively in research due to its high purity and biological activity.
VCAM-1 mediates the adhesion of lymphocytes, monocytes, eosinophils, and basophils to the vascular endothelium . This adhesion is crucial for the immune response, as it allows leukocytes to exit the bloodstream and enter tissues where they can combat infections or participate in inflammatory responses.
Additionally, VCAM-1 plays a role in leukocyte-endothelial cell signal transduction . This signaling is essential for the regulation of immune cell trafficking and the maintenance of vascular integrity.
VCAM-1 is implicated in several pathological conditions. It is known to play a role in the development of atherosclerosis, a condition characterized by the buildup of plaques in the arterial walls . The expression of VCAM-1 on endothelial cells is upregulated in response to inflammatory cytokines, leading to increased adhesion of leukocytes and the progression of atherosclerotic lesions.
VCAM-1 is also involved in rheumatoid arthritis, an autoimmune disease characterized by chronic inflammation of the joints . The increased expression of VCAM-1 in the synovial tissue of affected joints contributes to the recruitment of immune cells and the perpetuation of inflammation.
The human recombinant form of VCAM-1 produced in HEK cells is widely used in research to study its role in various diseases and to develop potential therapeutic interventions. For example, inhibitors of VCAM-1-mediated adhesion are being investigated as potential treatments for inflammatory diseases and cancer metastasis.
In addition, VCAM-1 is used as a biomarker for cardiovascular diseases and other inflammatory conditions. Elevated levels of VCAM-1 in the blood can indicate endothelial dysfunction and increased risk of atherosclerosis and other vascular diseases.
