UBE2B Human
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.
Description
The UE2B protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Product Specs
IMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVY
ADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQE
NKREYEKRVSAIVEQSWNDS.
Product Science Overview
Ubiquitin Conjugating Enzyme E2B (UBE2B), also known as UBC2, HR6B, or RAD6B, is a crucial enzyme in the ubiquitination pathway. This enzyme plays a significant role in the post-translational modification of proteins, which involves the attachment of ubiquitin molecules to substrate proteins. The human recombinant form of UBE2B is produced using recombinant DNA technology, typically in bacterial systems like E. coli.
UBE2B is a 19 kDa protein composed of 166 amino acids . It contains a 6xHis tag for purification purposes and is often purified using proprietary chromatographic techniques . The enzyme is homologous to the yeast DNA repair gene RAD6, which is induced by DNA-damaging agents . UBE2B can conjugate ubiquitin to histone H2A in an E3-independent manner in vitro and is essential for the multi-ubiquitination and degradation of N-end rule substrates .
Ubiquitination is a process that tags proteins for degradation by the proteasome, a large protein complex responsible for degrading unneeded or damaged proteins. UBE2B acts as an intermediary in this process by transferring activated ubiquitin from an E1 enzyme to a substrate protein, often with the help of an E3 ligase . This tagging process is crucial for maintaining cellular homeostasis and regulating various cellular processes, including DNA repair, cell cycle progression, and signal transduction .
The recombinant form of UBE2B is widely used in research to study the ubiquitination pathway and its implications in various diseases. For instance, UBE2B has been implicated in sepsis-induced muscle protein proteolysis and cancer-induced cachexia . Additionally, targeted protein degradation using chimeric human E2 ubiquitin-conjugating enzymes has been explored as a potential therapeutic strategy .
The recombinant UBE2B protein is typically lyophilized and should be reconstituted in sterile water to a concentration of at least 100 μg/ml . It is stable at room temperature for up to three weeks but should be stored desiccated below -18°C for long-term storage. Upon reconstitution, it should be stored at 4°C for short-term use and below -18°C for long-term use, with the addition of a carrier protein to prevent freeze-thaw cycles .
