SERPING1 Human HEK

Serpin Peptidase Inhibitor, Clade G Member 1 Human Recombinant HEK
Cat. No.
BT24936
Source
HEK293 cells.
Synonyms
C1IN, C1INH, C1NH, HAE1, HAE2 , Plasma protease C1 inhibitor, C1 esterase inhibitor, C1-inhibiting factor, Serpin G1, Name, SERPING1.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

SERPING1 Human Recombinant produced by transfected human cells is a single polypeptide chain containing 486 amino acids (23-500). SERPING1 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Product Specs

Introduction
Plasma protease C1 inhibitor (SERPING1) is a member of the serpin superfamily, known for inhibiting serine proteases. It plays a crucial role in regulating the complement and contact systems by controlling the activation of complement factor C1. SERPING1 achieves this by binding to the active catalytic site on the light chains of activated C1r and C1s. Deficiency in SERPING1 leads to hereditary angioedema, a condition characterized by recurring episodes of localized swelling (angioedema) affecting the skin, gastrointestinal mucosa, or upper respiratory mucosa.
Description
Recombinant human SERPING1, produced in transfected human cells, is a single polypeptide chain comprising 486 amino acids (23-500). It includes an 8-amino acid His-tag fused at the C-terminus and is purified using proprietary chromatographic techniques.
Physical Appearance
White, lyophilized (freeze-dried) powder, sterile-filtered.
Formulation
The lyophilized SERPING1 is provided in a 0.2 µM filtered solution containing 20mM Tris-HCl and 150mM NaCl at pH 8.0.
Solubility
For reconstitution, it is recommended to dissolve the lyophilized SERPING1 in 1xPBS to a minimum concentration of 100 µg/ml. This solution can be further diluted in other aqueous solutions as needed.
Stability
While the lyophilized SERPING1 remains stable at room temperature for up to 3 weeks, it is recommended to store it desiccated at temperatures below -18°C. After reconstitution, store SERPING1 at 4°C for 2-7 days. For long-term storage, keep it at -18°C. Avoid repeated freeze-thaw cycles.
Purity
Purity is determined to be greater than 95% using SDS-PAGE analysis.
Synonyms
C1IN, C1INH, C1NH, HAE1, HAE2 , Plasma protease C1 inhibitor, C1 esterase inhibitor, C1-inhibiting factor, Serpin G1, Name, SERPING1.
Source
HEK293 cells.
Amino Acid Sequence
NPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPILEVSSLPTTNSTTNSATKITANTTDEPTTQPTT
EPTTQPTIQPTQPTTQLPTDSPTQPTTGSFCPGPVTLCSDLESHSTEAVLGDALVDFSLKLYHAFSAMKK
VETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAI
RDTFVNASRTLYSSSPRVLSNNSDANLELINTWVAKNTNNKISRLLDSLPSDTRLVLLNAIYLSAKWKTT
FDPKKTRMEPFHFKNSVIKVPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVPQNLKHRLEDMEQ
ALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLCGLTEDPDLQVSAMQ
HQTVLELTETGVEAAAASAISVARTLLVFEVQQPFLFMLWDQQHKFPVFMGRVYDPRAVDHHHHHH

Product Science Overview

Structure and Function

SERPING1 is a highly glycosylated plasma protein that plays a significant role in controlling the activation of the complement system. The complement system is a part of the immune system that enhances the ability of antibodies and phagocytic cells to clear pathogens from an organism. SERPING1 specifically inhibits the activated forms of C1r and C1s proteases, which are components of the first complement component, C1 .

The protein forms a proteolytically inactive stoichiometric complex with these proteases, thereby regulating complement activation. This regulation is crucial for preventing excessive inflammation and tissue damage . Additionally, SERPING1 is involved in other physiological pathways, including blood coagulation, fibrinolysis, and the generation of kinins .

Clinical Significance

A deficiency in SERPING1 is associated with a condition known as Hereditary Angioedema (HAE). This genetic disorder is characterized by recurrent episodes of severe swelling (angioedema) in various parts of the body, including the extremities, face, gastrointestinal tract, and airway . The deficiency can be due to mutations that lead to either reduced levels of the protein or the production of a dysfunctional protein.

Recombinant Production

The recombinant form of SERPING1, produced in Human Embryonic Kidney (HEK) cells, is used for therapeutic purposes. Recombinant technology allows for the production of large quantities of the protein with high purity and activity. This recombinant protein is used in the treatment of HAE to replace the deficient or dysfunctional C1 inhibitor in patients .

Research and Applications

Research on SERPING1 continues to explore its broader implications in various physiological and pathological processes. Understanding its role in the complement system and other pathways can lead to the development of new therapeutic strategies for diseases related to immune dysregulation, coagulation disorders, and inflammatory conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.