SELE Human, HEK

E-Selectin Human Recombinant, HEK
Cat. No.
BT21392
Source
HEK293 cells.
Synonyms
E-selectin, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD62E antigen, SELE, ELAM1, ELAM, ESEL, CD62E.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

SELE Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 543 amino acids (22-556). SELE is fused to an 8 amino acid His-tag at C-terminus is purified by proprietary chromatographic techniques.

Product Specs

Introduction
E-selectin, also known as Endothelial leukocyte adhesion molecule 1 (ELAM1 or ELAM), is a member of the selectin family of adhesion molecules. These molecules are divalent cation-dependent carbohydrate-binding glycoproteins. E-selectin is expressed on the surface of endothelial cells, where it mediates the binding of leukocytes and platelets during inflammatory responses. The human E-selectin gene contains 14 exons and spans approximately 13 kb of DNA.
Description
Recombinant human SELE protein, expressed in a mammalian system using human cells, is a single polypeptide chain consisting of 543 amino acids (residues 22-556). The protein includes an 8 amino acid His-tag fused to the C-terminus and is purified using proprietary chromatographic techniques.
Physical Appearance
Sterile, white lyophilized (freeze-dried) powder.
Formulation
The SELE protein was lyophilized from a 0.2 µM filtered solution containing PBS and 4% Mannitol at pH 7.5.
Solubility
To reconstitute the lyophilized SELE protein, it is recommended to dissolve it in 1xPBS to a minimum concentration of 100 µg/ml. This solution can then be further diluted with other aqueous solutions.
Stability
Lyophilized SELE protein remains stable at room temperature for up to 3 weeks. However, for long-term storage, it should be stored desiccated at temperatures below -18°C. Once reconstituted, the SELE protein should be stored at 4°C for up to 7 days. For extended storage, it should be kept at -18°C. Repeated freeze-thaw cycles should be avoided.
Purity
The purity of the protein is determined to be greater than 95% by SDS-PAGE analysis.
Synonyms
E-selectin, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD62E antigen, SELE, ELAM1, ELAM, ESEL, CD62E.
Source
HEK293 cells.
Amino Acid Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVW
VWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTA
ACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSY
NSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPW
NTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFT
FKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFR
YGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTY
KSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKF
ACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH.

Product Science Overview

Structure and Properties

E-Selectin is a heavily glycosylated transmembrane protein. It consists of:

  • An N-terminal type 1 lectin domain
  • An EGF-like domain
  • Six sushi (CCP/SCR) domains
  • A transmembrane sequence
  • A short cytoplasmic domain

Recombinant human E-selectin is a 58.6kDa protein containing 535 amino acid residues, corresponding to the extracellular portion of the full-length protein. Due to glycosylation, E-selectin migrates at an apparent molecular weight of approximately 65-85kDa by SDS-PAGE analysis under reducing conditions .

Biological Function

E-Selectin plays a crucial role in the recruitment of circulating leukocytes from blood to sites of inflammation in the vascular lining through interaction with specific cell surface-associated carbohydrate determinants . It is a pro-angiogenic factor and has been implicated in the pathogenesis of stroke and atherosclerosis .

Expression and Production

The recombinant form of E-Selectin is expressed in HEK 293 cells. HEK (Human Embryonic Kidney) cells are commonly used for the production of recombinant proteins due to their high transfection efficiency and ability to perform post-translational modifications similar to those in human cells .

Applications

E-Selectin is used in various research applications, including:

  • Studying the mechanisms of leukocyte recruitment and inflammation
  • Investigating the role of E-Selectin in angiogenesis and vascular diseases
  • Developing therapeutic strategies targeting E-Selectin for inflammatory and cardiovascular diseases
Storage and Handling

Recombinant E-Selectin is typically lyophilized from a 0.22 μm filtered solution in PBS, pH 7.4, with mannitol or trehalose added as protectants before lyophilization. It should be reconstituted in sterile PBS, pH 7.4, to a concentration of 50 μg/mL and stored at 2-8°C for up to one month or at -20°C for extended storage .

E-Selectin is a vital molecule in the study of inflammation and vascular biology, providing insights into the mechanisms of leukocyte recruitment and the development of therapeutic interventions for related diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.