RSV Human
Escherichia Coli.
Sterile Filtered clear solution.
Protein is >90% pure as determined by 10% PAGE (coomassie staining).
Description
Recombinant Human Respiratory Syncytial Virus produced in E. coli having a Mw of 44kDa. RSV Human is fused to a 6xHis tag at its C terminal is and purified by proprietary chromatographic technique.
Product Specs
Escherichia Coli.
HMALSKVKLNDTLNKDQLLSSSKYTIQRSTGDSIDTPNYDVQKHINKLCGMLLITEDANHKFT GLIGMLYAMSRLGREDTIKILRDAGYHVKANGVDVTTHRQDINGKEMKFEVLTLASLTTEI QINIEIESRKSYKKMLKEMGEVAPEYRHDSPDCGMIILCIAALVITKLAAGDRSGLTAVI RRANNVLKNEMKRYKGLLPKDIANSFYEVFEKHPHFIDVFVHFGIAQSSTRGGSRVEGIFAG LFMNAYGAGQV MLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGFYHIL NNPKASLLSLTQFPHFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAAKAYAEQLKENGV
Product Science Overview
RSV was first isolated in 1955, but its biochemical and molecular characterization remained rudimentary for many years due to its relatively inefficient growth in cell culture, pleomorphic and cell-associated nature, and physical instability . The virus is known for causing severe respiratory illnesses such as bronchiolitis and pneumonia, particularly in young children and older adults .
RSV infections can occur all year round, but cases peak every winter. The virus spreads through coughs and sneezes, and it can be difficult to avoid infection even with preventive measures like covering your mouth and nose when coughing or sneezing and frequent hand washing . Symptoms of RSV infection often resemble those of a common cold, including cough, sore throat, sneezing, and a runny or blocked nose. In severe cases, it can lead to wheezing, shortness of breath, pneumonia, and other life-threatening conditions .
Human recombinant RSV refers to the use of recombinant DNA technology to produce RSV proteins or whole viruses for research, vaccine development, and therapeutic purposes. This approach allows scientists to study the virus in greater detail and develop effective vaccines and treatments. Recombinant RSV vaccines are designed to boost the immune system’s response to the virus, providing protection against severe respiratory illnesses caused by RSV .
Vaccination is the most effective way to protect against RSV infection. The RSV vaccine helps reduce the risk of serious breathing problems like pneumonia and bronchiolitis, especially in high-risk groups such as infants, older adults, and individuals with chronic lung conditions . The vaccine is typically given as an injection into the upper arm and is recommended during pregnancy and for adults aged 75 to 79 .
In conclusion, Respiratory Syncytial Virus (Human Recombinant) plays a crucial role in understanding and combating RSV infections. Through advanced research and vaccine development, we can better protect vulnerable populations from the severe respiratory illnesses caused by this virus.
