Recombinant HER2 Antibody

Recombinant Human Anti HER2
Cat. No.
BT25223
Source
CHO.
Synonyms
Appearance
Sterile filtered colorless liquid formulation.
Purity
Should be not less than 95.0% as determined by:
(a) Analysis by SEC-HPLC.
(b) Analysis by SDS-PAGE.
Usage

THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.

Shipped with Ice Packs
In Stock

Description

Recombinant Human Anti HER2 is produced by recombinant DNA technology in a Chinese Hamster Ovary mammalian cell expression system in a serum-free medium and has a molecular weight of approximately 148 kDa.

Product Specs

Introduction
HER-2/neu (erbB-2) encodes an 185-kDa orphan receptor tyrosine kinase that is constitutively active as a dimer and displays potent oncogenic activity when overexpressed. Herstatin, as the product of alternative HER-2 transcript, retains intron 8. The herstatin mRNA is expressed in normal human fetal kidney and liver, but is at reduced levels relative to p185HER-2 mRNA in carcinoma cells that contain an amplified HER-2 gene. Herstatin appears to be an inhibitor of p185HER-2, because it disrupts dimers, reduces tyrosine phosphorylation of p185, and inhibits the anchorage-independent growth of transformed cells that overexpress HER-2.
Description
Recombinant Human Anti HER2 is produced by recombinant DNA technology in a Chinese Hamster Ovary mammalian cell expression system in a serum-free medium and has a molecular weight of approximately 148 kDa.
Physical Appearance
Sterile filtered colorless liquid formulation.
Formulation
Each ml of Recombinant HER2 Antibody solution (32.1mg/ml) contains 0.56mg histidine-HCl, 0.36mg histidine and 0.1mg polysorbate-20, pH-6.
Stability
Recombinant Human Anti HER2 should be stored between 2-8°C.
Biological Activity
The ED50 as determined by the proliferation inhibition of BT474 cell, Perform a comparison of a dilution series of the Sample solution with a dilution series of the Standard solution, measured potency was found to be 0.9 x 104 EU/mg.
Purity
Should be not less than 95.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
Source
CHO.
Amino Acid Sequence
LIGHT CHAIN
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQ
KPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSL
QPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC
EVTHQGLSSPVTKSFNRGEC.

HEAVY CHAIN
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVR
QAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSK
NTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQ
GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP
PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS
HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV
LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR
EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK.

Product Science Overview

Introduction

Recombinant human anti-HER2 antibodies are a class of therapeutic proteins designed to target the human epidermal growth factor receptor 2 (HER2). HER2 is a member of the ErbB family of receptor tyrosine kinases, which play a crucial role in the regulation of cell growth and differentiation. Overexpression of HER2 is observed in approximately 20-30% of breast cancers and is associated with aggressive tumor growth and poor prognosis .

HER2 and Its Role in Cancer

HER2, also known as ErbB2, is a ligand-less receptor that forms heterodimers with other members of the ErbB family, such as HER1 (EGFR), HER3, and HER4. This dimerization leads to the activation of downstream signaling pathways that promote cell proliferation and survival . In normal cells, HER2 expression is tightly regulated, but in cancer cells, gene amplification or protein overexpression leads to uncontrolled cell growth and tumor development .

Development of Anti-HER2 Antibodies

The development of recombinant human anti-HER2 antibodies was driven by the need for targeted therapies that could specifically inhibit the activity of HER2 in cancer cells. Trastuzumab (Herceptin) was the first humanized monoclonal antibody approved for the treatment of HER2-positive breast cancer . Trastuzumab binds to the extracellular domain of HER2, preventing receptor dimerization and subsequent activation of downstream signaling pathways . Additionally, trastuzumab induces antibody-dependent cellular cytotoxicity (ADCC), leading to the destruction of cancer cells .

Mechanism of Action

Recombinant human anti-HER2 antibodies, such as trastuzumab, work through multiple mechanisms to inhibit tumor growth:

  1. Inhibition of HER2 Signaling: By binding to the extracellular domain of HER2, these antibodies prevent the receptor from dimerizing with other ErbB family members, thereby blocking the activation of downstream signaling pathways that promote cell proliferation and survival .
  2. Induction of ADCC: The Fc region of the antibody interacts with immune cells, such as natural killer (NK) cells, leading to the targeted killing of HER2-overexpressing cancer cells .
  3. Inhibition of HER2 Shedding: Trastuzumab has been shown to inhibit the proteolytic cleavage of HER2, preventing the release of the extracellular domain and the formation of a truncated, active receptor fragment known as p95HER2 .
Clinical Applications

Recombinant human anti-HER2 antibodies have shown significant clinical benefits in the treatment of HER2-positive breast cancer. Trastuzumab, in combination with chemotherapy, has been demonstrated to improve overall survival and reduce the risk of disease recurrence in patients with early-stage and metastatic HER2-positive breast cancer . Other anti-HER2 antibodies, such as pertuzumab and ado-trastuzumab emtansine (T-DM1), have also been developed and approved for clinical use .

Future Directions

Ongoing research aims to develop novel anti-HER2 therapies with improved efficacy and reduced resistance. Bispecific antibodies, which can simultaneously target HER2 and another receptor, are being investigated for their potential to enhance anti-tumor activity . Additionally, antibody-drug conjugates (ADCs) that deliver cytotoxic agents directly to HER2-overexpressing cancer cells are being explored as a means to improve therapeutic outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.