NRG1 Human

Heregulin-B2 Human Recombinant
Cat. No.
BT10075
Source
Escherichia Coli.
Synonyms
Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 96.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Recombinant Human Neuregulin-1 beta 2 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Neuregulin is a signaling protein that plays a crucial role in cardiac muscle cell function and structure. It acts by binding to ErbB2/ErbB4 receptor heterodimers, leading to their phosphorylation and promoting cardiomyocyte differentiation. Studies have shown that recombinant neuregulin can improve the organization of damaged myocardial cells and strengthen cell-to-cell connections. In animal models, neuregulin (NRG1) recombinant has demonstrated a protective effect against myocardial cell damage induced by ischemia, hypoxia, and viral infections.
Description
Recombinant Human Neuregulin-1 beta 2, produced in E. coli, is a single, non-glycosylated polypeptide chain with a molecular weight of 7.0kDa, comprising 61 amino acids. Purification is achieved through proprietary chromatographic techniques.
Physical Appearance
White, lyophilized (freeze-dried) powder, sterile-filtered.
Formulation
Lyophilized from a 0.2µm filtered solution in phosphate-buffered saline (PBS) at pH 7.4.
Solubility
Reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O to a concentration of at least 100µg/ml. Further dilutions can be prepared in other aqueous solutions.
Stability
Lyophilized NRG1 remains stable at room temperature for up to 3 weeks. For long-term storage, store desiccated below -18°C. Reconstituted Heregulin should be stored at 4°C for 2-7 days. For future use, store below -18°C. Avoid repeated freeze-thaw cycles.
Purity
Purity exceeds 96.0% as determined by: (a) Reverse-phase high-performance liquid chromatography (RP-HPLC) analysis. (b) Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis.
Biological Activity
The half-maximal effective concentration (ED₅₀), assessed through a cell proliferation assay using serum-free human MCF-7 cells, is less than 5ng/ml. This corresponds to a specific activity greater than 2.0 × 10⁵ U/mg.
Synonyms
Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1.
Source
Escherichia Coli.
Amino Acid Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ.

Product Science Overview

Introduction

Heregulin-B2, also known as Neuregulin-1 (NRG1), is a member of the neuregulin family of proteins. These proteins play a crucial role in cell signaling, particularly in the development and function of the nervous system and heart. Heregulin-B2 is a signaling protein that interacts with the ErbB family of receptors, specifically ErbB2 and ErbB4, to mediate various cellular processes .

Structure and Expression

Heregulin-B2 is a recombinant protein produced in Escherichia coli (E. coli). It is a single, non-glycosylated polypeptide chain containing 61 amino acids, with a molecular mass of approximately 7055 Daltons . The protein is typically lyophilized (freeze-dried) and can be reconstituted for use in various experimental applications.

Biological Functions

Heregulin-B2 plays a significant role in the development and maintenance of the nervous system and cardiac muscle cells. It induces the phosphorylation of ErbB2/ErbB4 receptor heterodimers, which leads to cardiomyocyte differentiation and improved heart structure and function . Additionally, Heregulin-B2 has been shown to stimulate the proliferation of human MCF-7 cells, a breast cancer cell line, under serum-free conditions .

Mechanism of Action

The interaction of Heregulin-B2 with ErbB receptors triggers a cascade of intracellular signaling pathways. These pathways involve the activation of various kinases and scaffold proteins, leading to changes in cell morphology, migration, and proliferation . In breast cancer cells, Heregulin-B2 signaling has been implicated in the development of an aggressive phenotype and resistance to anti-HER2 therapies such as trastuzumab and trastuzumab-emtansine .

Clinical Implications

Heregulin-B2’s role in cell signaling and proliferation makes it a potential target for therapeutic interventions in diseases such as cancer and heart disease. Research has shown that Heregulin-B2 can reduce the damage to myocardial cells caused by ischemia, hypoxia, and viral infections . In breast cancer, understanding the molecular mechanisms of Heregulin-B2 signaling can help develop more effective treatments to control cell motility and drug resistance .

Storage and Stability

Lyophilized Heregulin-B2 is stable at room temperature for up to three weeks but should be stored desiccated below -18°C for long-term storage. Upon reconstitution, it should be stored at 4°C for short-term use (2-7 days) and below -18°C for future use. It is important to avoid repeated freeze-thaw cycles to maintain the protein’s activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.