CoV-2 Nucleocapsid
CoV 2019 Nucleocapsid protein is >95% pure as determined SDS-PAGE.
Description
The E.Coli derived recombinant protein contains the Coronavirus 2019 full-length nucleocapsid: Gene bank- MN908947, fused to 6xHis tag at C-terminal and having a Mw. Of 48 kDa as appears on SDS-PAGE.
Product Specs
The 2019 novel coronavirus (2019-nCoV), a human-infecting coronavirus causing viral pneumonia, emerged in Wuhan, China, in December 2019, originating from a seafood market.
Sharing 87% genetic identity with the bat-derived SARS-CoV-2 found in Zhoushan, eastern China, in 2018, 2019-nCoV possesses a similar receptor-binding domain (RBD) structure. Despite minor variations, this suggests 2019-nCoV's potential to bind with the human ACE2 receptor (angiotensin-converting enzyme 2).
While bats are suspected as the natural reservoir of 2019-nCoV, intermediary animal hosts from the seafood market are hypothesized. Research suggests 2019-nCoV could be a recombinant virus, with its spike glycoprotein resulting from a combination of bat coronavirus and another unidentified coronavirus.
This product consists of the full-length nucleocapsid protein of the 2019 Coronavirus (Gene bank: MN908947), produced in E. coli. It is recombinantly designed with a C-terminal 6xHis tag and exhibits a molecular weight of 48 kDa as observed on SDS-PAGE.
The CoV 2019 protein solution is provided in a buffer consisting of PBS (phosphate-buffered saline) and 25mM K2CO3 (potassium carbonate).
The CoV 2019 Nucleocapsid protein is shipped with ice packs to maintain a low temperature. Upon receipt, it should be stored at -20°C.
The purity of the CoV 2019 Nucleocapsid protein is greater than 95%, as determined by SDS-PAGE analysis.
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKED
LKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGAN
KDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSR
SRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAA
EASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFF
GMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADE
TQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
Product Science Overview
Coronavirus disease 2019 (COVID-19), caused by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), has had a profound impact on global health and economies. The SARS-CoV-2 virus is composed of several structural proteins, among which the nucleocapsid (N) protein plays a crucial role in the viral life cycle and has become a focal point for vaccine and drug development .
The nucleocapsid protein is one of the four main structural proteins of SARS-CoV-2. It is highly conserved and is involved in the packaging of the viral RNA genome into ribonucleoprotein complexes (RNPs), which are essential for the assembly of new virus particles . The N protein is the most abundant protein in the virion and exhibits high immunogenicity, making it a prime target for diagnostic and therapeutic applications .
The N protein plays multiple roles in the SARS-CoV-2 life cycle. It is involved in the replication and transcription of viral RNA, the assembly of virions, and the modulation of host cell processes to facilitate viral replication . The protein’s ability to undergo liquid-liquid phase separation (LLPS) is critical for the formation of viral replication compartments within the host cell .
Recombinant N protein is produced using various expression systems, such as bacterial, yeast, insect, and mammalian cells. These recombinant proteins are used in research to study the structure and function of the N protein, as well as in the development of diagnostic assays and vaccines . The recombinant N protein retains the immunogenic properties of the native protein, making it suitable for use in serological tests to detect antibodies against SARS-CoV-2 .
The high immunogenicity of the N protein has led to its use in various diagnostic assays, including enzyme-linked immunosorbent assays (ELISAs) and lateral flow immunoassays (LFAs), to detect antibodies against SARS-CoV-2 . Additionally, the N protein is being explored as a potential target for vaccine development due to its ability to elicit a strong immune response .
