MIP 5 Human

Macrophage Inflammatory Protein-5 Human Recombinant (CCL15)
Cat. No.
BT21850
Source
Escherichia Coli.
Synonyms
Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Macrophage Inflammatory Protein-5 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1 kDa.
The MIP5 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
CCL15, also known as MIP-5, is a human CC chemokine discovered in a human fetal spleen cDNA library. The cDNA encodes a 113 amino acid protein, including a 21 amino acid signal peptide. After cleavage, the mature protein contains 92 amino acids. Human CCL15 shares amino acid sequence homology with several other CC family members: 45% with mouse C10, 44% with human MPIF-1, 35% with human HCC-1, and 30% with mouse MIP-1β. The gene encoding CCL15 is found on chromosome 17, which also houses the genes for most human CC chemokines. CCL15 is expressed in various immune cells, including T and B lymphocytes, NK cells, monocytes, and monocyte-derived dendritic cells. It acts as a chemoattractant for T cells and monocytes, and studies have shown that it can induce calcium flux in human cells transfected with the CCR-1 receptor.
Description
Recombinant Human Macrophage Inflammatory Protein-5 (MIP-5) is produced in E. coli. This non-glycosylated protein is a single polypeptide chain containing 92 amino acids with a molecular mass of 10.1 kDa. The purification process involves proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
MIP-5 is lyophilized from a concentrated solution (1mg/ml) containing 20mM PBS (pH 7.4) and 100mM NaCl.
Solubility
Reconstitute the lyophilized MIP-5 in sterile 18 MΩ-cm H2O to a concentration of at least 100 µg/ml. This solution can be further diluted in other aqueous solutions.
Stability
Lyophilized MIP-5 remains stable at room temperature for up to 3 weeks; however, it is recommended to store the lyophilized protein desiccated below -18°C. After reconstitution, CCL15 can be stored at 4°C for 2-7 days. For long-term storage, freeze aliquots at -18°C. It is important to avoid repeated freeze-thaw cycles. Adding a carrier protein (0.1% HSA or BSA) is recommended for long-term storage.
Purity
Purity is determined using the following methods: (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE. The purity is greater than 97.0%.
Biological Activity
Biological activity is determined by chemotaxis assay. It measures the protein's ability to attract human T-lymphocytes within a concentration range of 1-10 ng/ml. This corresponds to a specific activity of 100,000-1,000,000 IU/mg.
Synonyms
Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15.
Source
Escherichia Coli.
Amino Acid Sequence
QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI.

Product Science Overview

Structure and Composition

CCL15 is a non-glycosylated polypeptide chain consisting of 92 amino acids and has a molecular mass of approximately 10.1 kDa . The protein is produced in E. coli and is purified using proprietary chromatographic techniques . The amino acid sequence of CCL15 includes a series of conserved cysteine residues that are characteristic of the CC chemokine family .

Gene and Expression

The gene encoding CCL15 is located on chromosome 17 in humans, within a cluster of similar genes . CCL15 shares about 35% amino acid homology with another chemokine, CCL14 (HCC1) . The expression of CCL15 is most abundant in the heart, skeletal muscle, and adrenal gland, with lower levels found in the liver, small intestine, colon, and certain leukocytes and macrophages of the lung .

Biological Activity

CCL15 is known for its ability to chemoattract human T-lymphocytes and monocytes . It acts through the C-C chemokine receptor type 1 (CCR1) . The biological activity of CCL15 is determined by its ability to induce chemotaxis in human T-lymphocytes at concentrations ranging from 1-10 ng/ml, corresponding to a specific activity of 100,000-1,000,000 IU/mg .

Stability and Storage

Lyophilized CCL15 is stable at room temperature for up to three weeks but should be stored desiccated below -18°C for long-term stability . Upon reconstitution, it should be stored at 4°C for short-term use (2-7 days) and below -18°C for long-term storage . To prevent degradation, it is recommended to add a carrier protein such as 0.1% HSA or BSA and avoid repeated freeze-thaw cycles .

Applications

CCL15 is used in various research applications, including studies on immune response, inflammation, and cell signaling. Its ability to attract T-lymphocytes and monocytes makes it a valuable tool for investigating the mechanisms of immune cell migration and the role of chemokines in disease processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.