LGALS7 Human
Greater than 95.0% as determined by SDS-PAGE.
Description
Galectin-7 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 136 amino acids and having a molecular mass of 15kDa.
The LGALS7 is purified by proprietary chromatographic techniques.
Product Specs
Recombinant Human Galectin-7, produced in E. coli, is a single, non-glycosylated polypeptide chain composed of 136 amino acids, resulting in a molecular weight of 15kDa. The purification of LGALS7 is achieved through proprietary chromatographic techniques.
LGALS7 was lyophilized from a concentrated (1mg/ml) solution in 20mM Tris, 150mM NaCl, 1mM EDTA and 5% Trehalose, pH 8.
To reconstitute the lyophilized Galectin-7, it is recommended to dissolve it in sterile distilled H2O at a concentration of at least 100µg/ml. This solution can then be further diluted in other aqueous solutions as needed.
The purity of the protein is determined to be greater than 95.0% as assessed by SDS-PAGE analysis.
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNP
RLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQ
YHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Product Science Overview
Galectin-7 was first reported by Celis in 1995 while searching for keratinocyte proteins that may play a role in maintaining the normal phenotype and various skin diseases . The protein is expressed in stratified epithelia and is involved in apoptotic responses, proliferation, differentiation, cell adhesion, and migration .
The expression of Galectin-7 is induced by the tumor suppressor protein p53 and is associated with apoptosis . It has diverse effects on many cellular functions, including:
- Adhesion: Galectin-7 plays a role in cell-cell and cell-matrix interactions.
- Migration: It is involved in the movement of cells, which is crucial for wound healing and immune responses.
- Polarity: Galectin-7 helps maintain the orientation of cells within tissues.
- Chemotaxis: It guides the movement of cells in response to chemical stimuli.
- Proliferation: Galectin-7 influences cell division and growth.
- Apoptosis: It is involved in programmed cell death, which is essential for removing damaged or unwanted cells .
Recombinant human Galectin-7 is produced using an E. coli expression system. The target protein is expressed with the sequence Met1-Phe136 of human LGALS7 (Accession #P47929) . The recombinant protein is typically purified to a high degree of purity (>95%) and is used in various research applications .
Recombinant human Galectin-7 is used in research to study its role in various pathological states, including autoimmune diseases, allergic reactions, inflammation, tumor cell metastasis, atherosclerosis, and diabetic complications . It is also used to investigate its potential as a therapeutic target in cancer and other diseases .
