IL37 Human

Interleukin-37 Human Recombinant
Cat. No.
BT16955
Source
Escherichia Coli.
Synonyms
Interleukin-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, IL-1F7, Interleukin-1 homolog 4, IL-1H, IL-1H4, Interleukin-1 zeta, IL-1 zeta, Interleukin-1-related protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1, FIL1, FIL1(ZETA).
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity

Greater than 95.0% as determined by SDS-PAGE.

Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192)  and having a molecular mass of 18.6kDa.
The IL37 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Human interleukin 1 family member 7 (IL1F7), also known as IL-37, is a cytokine that acts as a natural suppressor of innate immunity. It exists in multiple isoforms with varying lengths and expression patterns. The longest isoform, IL1F7b, can bind to the interleukin-18 receptor (IL18R) with low affinity but does not activate it. Instead, IL1F7b interacts with the IL-18 binding protein (IL18BP), forming a complex that prevents IL-18 from binding to its receptor and initiating an inflammatory response.
Description
This product consists of the recombinant form of human Interleukin-37, produced in E. coli. It is a non-glycosylated polypeptide chain encompassing 167 amino acids (Lys27-Asp192) with a molecular weight of 18.6 kDa. The protein has been purified using specialized chromatographic techniques to ensure its high quality.
Physical Appearance
The product is provided as a sterile, white powder that has been lyophilized (freeze-dried) to maintain its stability.
Formulation

The lyophilization of IL37 was carried out from a 0.2 µM filtered solution containing 20mM PB (phosphate buffer), 150mM NaCl (sodium chloride), and 2mM DTT (dithiothreitol) at a pH of 7.4.

Solubility
For optimal use, it is recommended to briefly centrifuge the vial before reconstituting the lyophilized IL37 in phosphate-buffered saline (PBS) to a minimum concentration of 100 µg/ml. This solution can then be further diluted in other aqueous solutions as needed.
Stability
Lyophilized IL37 remains stable for up to 3 weeks at room temperature, but for long-term storage, it is best kept desiccated at a temperature below -18°C. Once reconstituted, the IL-37 solution should be stored at 4°C for 2-7 days. For extended storage, it can be kept at -18°C, but repeated freeze-thaw cycles should be avoided.
Purity

The purity of the IL37 is greater than 95.0%, as determined by SDS-PAGE analysis.

Biological Activity
The protein's biological activity, specifically its binding ability, has been assessed using a functional ELISA. Immobilized IL1F7 at a concentration of 1 µg/ml (100 µl/well) can bind to recombinant human IL-18 Receptor/Fc Chimera within a linear range of 0.015-1 µg/ml.
Synonyms
Interleukin-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, IL-1F7, Interleukin-1 homolog 4, IL-1H, IL-1H4, Interleukin-1 zeta, IL-1 zeta, Interleukin-1-related protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1, FIL1, FIL1(ZETA).
Source
Escherichia Coli.
Amino Acid Sequence
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEK
GSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYR
AQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAE
MSPSEVSD.

Product Science Overview

Introduction

Interleukin-37, formerly known as Interleukin-1 Family Member 7, is a member of the Interleukin-1 family of cytokines. It is a newly discovered cytokine that plays a crucial role in suppressing innate inflammation and acquired immune responses. Interleukin-37 has five isoforms, designated as Interleukin-37a through Interleukin-37e, with Interleukin-37b being the most studied and longest isoform .

Biological Function

Interleukin-37 functions as a natural inhibitor of inflammatory and immune responses. It has been shown to suppress the production of pro-inflammatory cytokines such as Interleukin-1 alpha, Interleukin-1 beta, and Tumor Necrosis Factor alpha. Overexpression of Interleukin-37 in epithelial cells or macrophages almost completely suppresses the production of these cytokines, whereas silencing of endogenous Interleukin-37 increases their abundance in human blood cells .

Therapeutic Potential

Due to its potent anti-inflammatory properties, Interleukin-37 holds significant potential for treating a wide array of human inflammatory and autoimmune disorders. Studies have shown that administration of recombinant Interleukin-37 can ameliorate experimental psoriasis, alleviate rheumatoid arthritis, and reduce bleomycin-induced lung injury and fibrosis. It has also been found to decrease renal ischemia-reperfusion injury and inhibit the growth of cancer cells .

Recombinant Production

Recombinant Interleukin-37 can be produced using various expression systems, including bacterial, yeast, insect, and mammalian cells. Recently, plants have emerged as a novel expression platform for the production of human Interleukin-37. Transgenic plants have been developed to produce different forms of Interleukin-37b, including the unprocessed full-length precursor form and the mature form. The expression of these forms is driven by a strong constitutive promoter, and the resulting proteins are biologically active .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.