HIV-2 gp-36 397aa

HIV-2 gp36 397aa Recombinant
Cat. No.
BT24339
Source
Escherichia Coli.
Synonyms
Appearance
Sterile filtered colorless clear solution.
Purity
Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus.

Product Specs

Introduction
HIV-1 and HIV-2 are two distinct types of human immunodeficiency viruses with differences in their RNA packaging and disease progression. HIV-1 binds to any suitable RNA, while HIV-2 prefers its own mRNA encoding the Gag protein. This difference contributes to HIV-1's higher mutation rate. Both viruses spread through bodily fluids like blood and semen. HIV-2 progresses slower to immunodeficiency and is initially less infectious than HIV-1. However, its infectivity rises with disease progression. Significant differences include HIV-2's lower pathogenicity, stronger immune control, and frequent CD4 independence. Despite differences in sequence and phenotype, their envelopes share structural similarities, both forming 6-helix bundles crucial for fusion. Though HIV-1 gp41 forms more stable bundles, HIV-2 fusion occurs at a lower temperature, doesn't need calcium, and is unaffected by cytochalasin B or target cell glycosphingolipid composition.
Description
This recombinant HIV-2 gp36 protein, with a size of 34 kDa, encompasses 397 amino acids of the HIV-2 envelope's immunodominant gp36 region. It is expressed as a fusion protein with beta-galactosidase (114 kDa) at its N-terminus.
Physical Appearance
A clear, colorless solution that has been sterilized by filtration.
Formulation
The solution contains 0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, and 0.05% Tween-20.
Purity
HPLC analysis and SDS-PAGE confirm a purity exceeding 95%.
Stability
While HIV-2 gp-36 remains stable for up to one week at 4°C, it is recommended to store it below -18°C to ensure long-term stability. Avoid repeated freeze-thaw cycles.
Source
Escherichia Coli.
Amino Acid Sequence
EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCH
IKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQ
NNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEK
RYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQS
RTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVT
AIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDN
MTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNS
WDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQML
SRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGG
SNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC.
Specificity
Reactive with human HIV positive serum.

Product Science Overview

Introduction

HIV-2 gp36 is a glycoprotein found in the envelope of the Human Immunodeficiency Virus type 2 (HIV-2). This protein plays a crucial role in the virus’s ability to infect host cells and is a key target for diagnostic and therapeutic research. The recombinant form of HIV-2 gp36, specifically the 397 amino acid (aa) variant, is used extensively in laboratory research to study the virus’s properties and to develop diagnostic tools.

Structure and Composition

The HIV-2 gp36 397aa recombinant protein is a 34 kDa protein that contains 397 amino acids. It includes the sequence of the HIV-2 envelope immunodominant regions, which are critical for the virus’s ability to bind and enter host cells . The protein is often fused to beta-galactosidase at the N-terminus, which aids in its detection and purification during laboratory experiments .

Expression and Purification

The recombinant HIV-2 gp36 protein is typically expressed in Escherichia coli (E. coli) bacteria. This expression system is chosen because it allows for high-yield production of the protein, which is essential for research purposes. The protein is then purified to a high degree of purity, often greater than 95%, using techniques such as High-Performance Liquid Chromatography (HPLC) and Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) .

Applications in Research

The HIV-2 gp36 397aa recombinant protein is used in various research applications, including:

  1. Diagnostic Development: The protein is used to develop diagnostic assays, such as Enzyme-Linked Immunosorbent Assays (ELISA), which detect antibodies against HIV-2 in human serum .
  2. Vaccine Research: Researchers study the protein to understand how the immune system responds to HIV-2, which can inform the development of vaccines.
  3. Therapeutic Research: The protein is also used to screen for potential therapeutic agents that can inhibit the virus’s ability to infect host cells.
Stability and Storage

The HIV-2 gp36 397aa recombinant protein is stable at 4°C for up to one week. For long-term storage, it should be kept below -18°C to prevent degradation. It is important to avoid repeated freeze-thaw cycles, as these can reduce the protein’s stability and effectiveness .

Safety and Handling

As with all recombinant proteins, the HIV-2 gp36 397aa recombinant protein should be handled with care in a laboratory setting. It is intended for research use only and should not be used as a drug, food additive, or household chemical .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.