HGF Human

Hepatocyte Growth Factor Human Recombinant
Cat. No.
BT15776
Source
Insect cells.
Synonyms
Scatter Factor (SF), Hepatopoietin (HPTA), HGF, HGFB, F-TCF.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.
The HGF is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Hepatocyte Growth Factor (HGF) is a versatile growth factor that governs both cell growth and movement. It exhibits a potent mitogenic effect on hepatocytes and primary epithelial cells. Additionally, HGF acts synergistically with Interleukin-3 and GM-CSF to promote colony formation of hematopoietic progenitor cells in vitro, suggesting a potential role in regulating hematopoiesis.
Description
Recombinant Human Hepatocyte Growth Factor, produced in Baculovirus, is a non-glycosylated polypeptide chain heterodimer consisting of 692 amino acids with a total molecular weight of 78.0 KDa. The purification process of HGF involves proprietary chromatographic techniques.
Physical Appearance
Sterile, white, lyophilized powder.
Formulation
The sterile protein powder is lyophilized at a concentration of 1 mg/ml in a solution of 50mM acetic acid.
Solubility
It is advised to reconstitute the lyophilized Hepatocyte Growth Factor in 50mM acetic acid to achieve a concentration of at least 100 µg/ml. Subsequent dilutions should be prepared using a buffer containing protein.
Stability
Lyophilized Hepatocyte Growth Factor remains stable at room temperature for up to 3 weeks; however, it is recommended to store it desiccated below -18°C. After reconstitution, HGF should be stored at 4°C for 2-7 days. For long-term storage, it is advisable to freeze it below -18°C. To ensure optimal stability during long-term storage, consider adding a carrier protein such as 0.1% HSA or BSA. Avoid repeated freeze-thaw cycles.
Purity
The purity is determined to be greater than 95.0% as assessed by SDS-PAGE.
Biological Activity
The biological activity was evaluated based on the scattering activity in the MDCK cell assay. The ED50 for this effect is typically within the range of 2.0-5.0 ng/ml.
Synonyms
Scatter Factor (SF), Hepatopoietin (HPTA), HGF, HGFB, F-TCF.
Source
Insect cells.
Amino Acid Sequence
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK
AFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGT
VSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRY
EVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPD
KGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECI
QGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSM
WDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISR
CEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGS
LIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEG
SDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLR
VAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKM
RMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS.

Product Science Overview

Introduction

Hepatocyte Growth Factor (HGF), also known as scatter factor, is a multifunctional cytokine that plays a crucial role in various biological processes, including cell growth, motility, and morphogenesis. Initially identified as a potent mitogen for hepatocytes, HGF has since been recognized for its broader biological activities.

Historical Background

HGF was first reported in 1984 as a potent mitogen for rat hepatocytes in primary culture . The primary structure of HGF was elucidated in 1989 through cDNA cloning, revealing it as a novel growth factor . Around the same time, scatter factor was identified from fibroblast-cultured media as a factor inducing scattering in epithelial cells. Subsequent biochemical analyses revealed that HGF and scatter factor are identical .

Molecular Structure

The HGF gene is located on chromosome 7q21.1 and comprises 18 exons and 17 introns . Mature HGF is a heterodimer composed of disulfide-linked α- and β-chains. The α-chain contains an N-terminal hairpin domain and four kringle domains, while the β-chain contains a serine proteinase homology domain . HGF is biosynthesized as an inactive single chain and is activated through cleavage by several serine proteinases .

Biological Functions

HGF stimulates hepatocyte proliferation and acts as an anti-apoptotic factor, making it a potential therapeutic agent for treating fatal liver diseases . It also plays a role in cell motility, morphogenesis, and tissue regeneration. The HGF-Met signaling pathway is essential for various developmental and physiological processes .

Recombinant Human HGF

Recombinant human HGF (rh-HGF) is produced using genetic engineering techniques. It is expressed in a mouse myeloma cell line (NSO) and is used in various clinical and research applications . The recombinant form retains the biological activities of natural HGF and has been evaluated for its therapeutic potential in clinical trials .

Clinical Applications

rh-HGF has been investigated for its potential in treating acute liver failure (ALF) and other liver diseases. Clinical trials have shown that rh-HGF can be administered safely, with manageable side effects such as a moderate decrease in blood pressure . Further research is needed to determine its efficacy at higher doses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

MET Human
Met Proto-Oncogene Human Recombinant
Cat. No.
BT11667
Source
Insect cells.
HGF (32-285) Human
Hepatoma-Derived Growth Factor (32-285 a.a) Human Recombinant
Cat. No.
BT15613
Source
Escherichia Coli.
HGF B Human
Hepatocyte Growth Factor B Chain Human Recombinant
Cat. No.
BT15683
Source
Escherichia Coli.
pHGF Porcine
Hepatocyte promoting Growth Factor Porcine
Cat. No.
BT16117
Source
Pig Liver.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.