HBsAg adw2

Hepatitis B Surface Antigen, adw2 Recombinant
Cat. No.
BT7912
Source
Escherichia Coli.
Synonyms
Appearance
Sterile filtered colorless solution.
Purity
Greater than 90.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

HbsAg subtype adw2 produced in E.Coli, is a single, non-glycosylated, polypeptide chain containing 226 amino acids and having a molecular weight of approximately 23.0kDa. HBsAg adw2 migrates on SDS-PAGE as a 23kDa monomer band with minor amounts of dimer (46kDa) and trimer (69kDa) forms.
The HBsAg is fused to a 6 His tag on C-terminus and purified by proprietary chromatographic techniques.

Product Specs

Introduction
HBsAg, also known as the Australia Antigen, is the surface antigen of the Hepatitis B Virus (HBV). This antigen is a protein that specifically binds to one of the surface proteins found on the viral capsid.
Description
Produced in E. coli, HBsAg subtype adw2 is a non-glycosylated polypeptide chain consisting of 226 amino acids. With a molecular weight of approximately 23.0kDa, it presents as a monomer band on SDS-PAGE, with minor dimer (46kDa) and trimer (69kDa) formations. The HBsAg is tagged with a 6 His tag at the C-terminus and purified using proprietary chromatographic techniques.
Physical Appearance
Colorless, sterile, and filtered solution.
Formulation
The product is provided as a sterile filtered solution containing 50mM potassium phosphate.
Stability
For optimal storage, keep at 4°C if the entire vial will be used within 2-4 weeks. For long-term storage, freeze at -20°C. The addition of a carrier protein (0.1% HSA or BSA) is recommended for extended storage. Avoid repeated freeze-thaw cycles.
Purity
The purity is determined to be greater than 90.0% by SDS-PAGE analysis.
Source
Escherichia Coli.
Amino Acid Sequence

MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH

SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGP

CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFV

QWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI

Product Science Overview

Introduction

Hepatitis B Surface Antigen (HBsAg) is a protein component of the Hepatitis B virus (HBV) envelope. It plays a crucial role in the virus’s ability to infect liver cells and is a key target for diagnostic tests and vaccines. The “adw2” subtype refers to a specific variant of HBsAg, which is used in various research and clinical applications.

Production and Expression

The recombinant form of HBsAg, adw2, is produced using genetic engineering techniques. The gene encoding the HBsAg is inserted into the DNA of a host organism, typically yeast cells such as Saccharomyces cerevisiae or Pichia pastoris. These genetically modified cells then express the HBsAg protein, which can be harvested and purified for use .

Purification and Formulation

The recombinant HBsAg, adw2, undergoes several purification steps to ensure high purity and quality. Common methods include ionic exchange chromatography, size exclusion chromatography, and sterile filtration. The final product is often formulated in a phosphate buffer solution with sodium chloride to maintain stability and activity .

Applications
  1. Vaccines: Recombinant HBsAg is a critical component of hepatitis B vaccines. It stimulates the immune system to produce antibodies against HBV, providing protection against infection. For example, the ENGERIX-B vaccine contains purified HBsAg produced in Saccharomyces cerevisiae .
  2. Diagnostic Tests: HBsAg is used in diagnostic assays to detect HBV infection. These tests can identify the presence of HBsAg in blood samples, indicating an active or past infection.
  3. Research: Recombinant HBsAg is used in various research applications, including studying the structure and function of the HBV envelope, developing new diagnostic methods, and testing antiviral drugs .
Storage and Stability

Recombinant HBsAg, adw2, should be stored at 4°C and should not be frozen to maintain its stability and activity. The protein is typically provided in a sterile filtered solution to prevent contamination .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.