HBeAg
Protein is >95%
Description
Recombinant hepatitis B virus “e” antigen VLP (virus like particle)produced in E.coli, is a 149a.a protein and having a molecular mass of approximately 18kDa. The HBeAg sequence is derived from HBV adw2 and fused to His Tag at C-terminus.
Product Specs
Hepatitis B virus (HBV) is a major cause of liver disease worldwide. Chronic HBV infection can lead to serious complications such as liver cancer and cirrhosis. The virus's core gene produces two key proteins: HBcAg and HBeAg. HBcAg forms the viral nucleocapsid, which encases the viral DNA and essential enzymes. HBeAg, on the other hand, is a secreted protein that plays a role in immune evasion. It circulates in the bloodstream during active infection and serves as a marker of viral replication and infectivity.
The presence of HBeAg in a patient's blood signifies active HBV infection and a higher risk of transmission. Monitoring HBeAg levels is crucial for assessing treatment response, as its disappearance often indicates successful suppression of viral replication and a reduced risk of long-term complications.
This recombinant Hepatitis B e antigen (HBeAg) is a virus-like particle (VLP) produced in E. coli. It consists of a 149 amino acid sequence derived from the HBV adw2 subtype, with a C-terminal His tag for purification. This non-infectious VLP mimics the structure and antigenic properties of native HBeAg, making it suitable for research and diagnostic applications.
>95% pure
Supplied in 20mM Tris-HCl buffer (pH adjusted), 0.5M NaCl, 0.8M imidazole
For short-term storage (up to 1 week), HBeAg can be stored at 4°C. For long-term storage, it is recommended to store aliquots at -18°C or below. Repeated freezing and thawing should be avoided to maintain protein integrity and activity.
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNL
EDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVV
Product Science Overview
Hepatitis B virus (HBV) is a significant global health concern, causing both acute and chronic liver infections. One of the key markers of HBV infection is the hepatitis B e-antigen (HBeAg), a secreted protein that plays a crucial role in the virus’s life cycle and pathogenesis. The recombinant form of HBeAg has been instrumental in advancing our understanding of HBV and developing diagnostic and therapeutic tools.
HBV is a DNA virus belonging to the Hepadnaviridae family. It has a complex structure with several antigens, including the surface antigen (HBsAg), core antigen (HBcAg), and e-antigen (HBeAg). HBeAg is derived from the precore protein, which is processed and secreted into the bloodstream during active viral replication .
The presence of HBeAg in the serum generally indicates active viral replication and high infectivity. It is associated with the early phase of HBV infection and is used as a marker to monitor disease progression and treatment response. HBeAg is believed to modulate the host immune response, helping the virus evade detection and establish chronic infection .
Recombinant DNA technology has enabled the production of HBeAg in vitro, providing a valuable tool for research and clinical applications. Recombinant HBeAg is produced by inserting the gene encoding the antigen into a suitable expression system, such as Escherichia coli or yeast. This allows for the large-scale production of pure and consistent antigen, which is essential for developing diagnostic assays and vaccines .
- Diagnostic Assays: Recombinant HBeAg is used in various diagnostic tests to detect HBV infection and monitor treatment efficacy. These assays are crucial for identifying carriers, assessing viral load, and determining the stage of infection.
- Vaccine Development: While HBsAg is the primary component of HBV vaccines, recombinant HBeAg has been explored as a potential vaccine candidate. Its role in modulating the immune response makes it an attractive target for therapeutic vaccines aimed at inducing a robust immune response against HBV.
- Research: Recombinant HBeAg is widely used in research to study the molecular mechanisms of HBV infection, immune evasion, and pathogenesis. It provides a consistent and reliable source of antigen for various experimental applications .
