HTNV
HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining).
Description
The Hantavirus nucleocapsid (N) fusion protein is expressed in E. coli and is fused to 6xHis tag. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.
Product Specs
HTNV is supplied in a solution of 1xPBS at pH 7.4 with 0.05% sodium azide.
Store at -20°C upon receipt. Avoid repeated freeze-thaw cycles.
HTNV protein purity exceeds 95%, determined by 12% PAGE (Coomassie staining).
GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD
Product Science Overview
Hantaviruses are a genus within the family Hantaviridae, known for causing serious illnesses in humans, such as Hantavirus Pulmonary Syndrome (HPS) and Hemorrhagic Fever with Renal Syndrome (HFRS) . These viruses are primarily transmitted to humans through contact with rodent excreta, including urine, droppings, or saliva .
Hantaviruses are enveloped viruses with a tripartite negative-stranded RNA genome, consisting of three segments: the small (S), medium (M), and large (L) segments . The S segment encodes the nucleocapsid protein, the M segment encodes the glycoproteins (Gn and Gc), and the L segment encodes the RNA-dependent RNA polymerase .
Recombinant proteins are proteins that are genetically engineered in the laboratory by inserting the gene encoding the protein into a host organism, such as bacteria or yeast, which then produces the protein. In the context of Hantaviruses, recombinant proteins are used for various purposes, including vaccine development, diagnostic assays, and therapeutic research.
-
Vaccine Development: Recombinant Hantavirus proteins are being explored as potential vaccine candidates. These proteins can elicit an immune response in the host, providing protection against Hantavirus infections. For example, the glycoproteins Gn and Gc are key targets for vaccine development due to their role in virus entry and immune recognition .
-
Diagnostic Assays: Recombinant Hantavirus proteins are used in diagnostic assays to detect Hantavirus infections. These assays can identify antibodies against Hantavirus in patient samples, aiding in the diagnosis of HPS and HFRS .
-
Therapeutic Research: Recombinant proteins are also used in therapeutic research to develop treatments for Hantavirus infections. For instance, neutralizing antibodies generated from Hantavirus convalescent patients have shown efficacy against Hantavirus infections . Additionally, RNA interference (RNAi) and small interfering RNA (siRNA) therapies are being investigated to target specific gene segments of the Hantavirus .
