EPHB4 Mouse
Description
EPHB4 is expressed with an 8 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.
Product Specs
GWVPRRGAVHVYATIRFTMMECLSLPRASRSCKETFTVFYYESEADTATAHTPAWMENPY
IKVDTVAAEHLTRKRPGAEATGKVNIKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYK
KCSWLITNLTYFPETVPRELVVPVAGSCVANAVPTANPSPSLYCREDGQWAEQQVTGCSC
APGYEAAESNKVCRACGQGTFKPQIGDESCLPCPANSHSNNIGSPVCLCRIGYYRARSDP
RSSPCTTPPSAPRSVVHHLNGSTLRLEWSAPLESGGREDLTYAVRCRECRPGGSCLPCGG
DMTFDPGPRDLVEPWVAIRGLRPDVTYTFEVAALNGVSTLATGPPPFEPVNVTTDREVPP
AVSDIRVTRSSPSSLILSWAIPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELR
GLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESESWREQLAVEHHHHHH.
Product Science Overview
EPH Receptor B4 (EphB4) is a member of the Eph receptor tyrosine kinase family, which plays a crucial role in various biological processes, including cell migration, axon guidance, and angiogenesis. EphB4, also known by other names such as Htk, Myk1, Tyro11, and Mdk2, specifically binds to its ligand, Ephrin-B2 .
EphB4 is a transmembrane protein that consists of several domains:
- Extracellular Domain (ECD): This domain is responsible for ligand binding and consists of a ligand-binding domain, a cysteine-rich domain, and two fibronectin type III repeats.
- Transmembrane Segment: This short segment anchors the receptor in the cell membrane.
- Cytoplasmic Domain: This domain contains a tyrosine kinase domain, which is crucial for signal transduction .
The interaction between EphB4 and Ephrin-B2 triggers bidirectional signaling, where both the receptor and the ligand transduce signals into their respective cells. This signaling is essential for various developmental processes, including vascular development and neural network formation .
Recombinant EphB4 proteins are produced using various expression systems, including bacterial, yeast, and mammalian cells. The recombinant mouse EphB4 is often expressed in mouse myeloma cell lines (NS0) and purified to high levels of purity (>95%) using techniques such as SDS-PAGE under reducing conditions .
Recombinant EphB4 has several applications in research and medicine:
- Cell Signaling Studies: It is used to study the mechanisms of cell signaling and the role of EphB4 in various cellular processes.
- Angiogenesis Research: EphB4 is crucial for blood vessel formation and remodeling, making it a valuable tool in angiogenesis research.
- Cancer Research: EphB4 is involved in tumor angiogenesis and metastasis, making it a potential target for cancer therapy .
