Der P1

Der P1 Protein Recombinant
Cat. No.
BT17261
Source
Escherichia Coli.
Synonyms
Peptidase 1, Major mite fecal allergen Der p 1, Allergen Der p I, Der p 1, DERP1, Der-P1.
Appearance
Purity
Protein is >95% pure as determined by 10% SDS-PAGE (coomassie staining).
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

The E.Coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.5kDa, pI 5.6.

Product Specs

Introduction
DERP1, a C1 peptidase family member, is a thiol protease with a specificity for substrates containing a large hydrophobic side chain at the P2 position or basic residues. Exhibiting extensive endopeptidase activity, DERP1 is N-glycosylated; however, N-glycanase treatment doesn't completely eliminate carbohydrates, hinting at additional glycosylation sites. This protein is known to trigger allergic responses in humans, particularly those with house dust allergy, with symptoms like bronchial asthma, allergic rhinitis, and conjunctivitis. Notably, DERP1 binds to IgE in a significant proportion (80%) of individuals with house dust allergy.
Description
This recombinant protein, derived from E. coli, consists of the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (amino acids 20-320) with a C-terminal 6-His tag. It has a molecular weight of 34.5 kDa and an isoelectric point of 5.6.
Purity
The purity of the protein exceeds 95% as assessed by 10% SDS-PAGE and visualized by Coomassie staining.
Formulation
The protein is formulated in a buffer containing 60mM NaCl and 50mM Tris-HCl at pH 8.0.
Stability
For optimal storage, Der-P1 should be kept at -18°C or below. While it can remain stable at 4°C for a week, it's crucial to avoid repeated freeze-thaw cycles.
Synonyms
Peptidase 1, Major mite fecal allergen Der p 1, Allergen Der p I, Der p 1, DERP1, Der-P1.
Source
Escherichia Coli.
Amino Acid Sequence
MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK
NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS
GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA
REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI
IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY
VVILHHHHHH.
Purification Method

Purified by proprietary chromatographic technique.

Product Science Overview

Structure and Function

Der P1 is a thiol protease with a preference for substrates that have a large hydrophobic side chain in the P2 position or basic residues . It is a member of the C1 peptidase family and exhibits extensive endopeptidase specificity . The protein is also N-glycosylated, meaning it has carbohydrate groups attached to it, which can affect its function and allergenicity .

Allergenic Properties

Der P1 is highly allergenic and is one of the primary causes of perennial asthma worldwide . Chronic exposure to Der P1 occurs through inhalation, leading to the production of IgE antibodies in susceptible individuals . The allergenicity of Der P1 is partly due to its ability to cleave various receptors on human cells, such as the CD23 receptor on B cells and the IL-2 receptor on T cells .

Recombinant Der P1 Protein

Recombinant Der P1 Protein is produced using E. coli as a host organism . This recombinant form is used in research and diagnostic applications to study the allergenic properties of Der P1 and to develop potential treatments for allergies caused by house dust mites .

Research and Applications

Research on Der P1 has provided detailed insights into the interactions between this allergen and antibodies. For example, structural analyses have revealed the epitopes (specific parts of the allergen that antibodies bind to) and how these interactions contribute to the allergenicity of Der P1 . This information is valuable for designing immunotherapies that can reduce the binding of antibodies to Der P1, potentially alleviating allergic reactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.