CDH1 Human, HEK

E-Cadherin Human Recombinant, HEK
Cat. No.
BT27516
Source
HEK cells.
Synonyms
Epithelial cadherin, E-cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324 antigen, CDH1, CDHE, UVO, ECAD, LCAM, Arc-1, CD324, Cadherin-E.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

E-Cadherin Human Recombinant produced in HEK cells is a secreted protein with the sequence of Human E-Cadherin (amino acids Asp155-Ile707) and fused to a 6xHis tag at the C-terminus.

Product Specs

Introduction
E-cadherin, also known as uvomorulin or cell-CAM120/80, is a calcium-dependent cell adhesion molecule primarily found in epithelial tissues. It plays a crucial role in cellular growth and development by regulating tissue structure and maintaining tissue integrity. Extensive research has shown a strong correlation between the loss or reduction of E-cadherin expression in carcinomas and their potential for invasion and metastasis.
Description
Recombinant Human E-Cadherin, expressed in HEK cells, is a secreted protein encompassing amino acids Asp155 to Ile707 of the human E-Cadherin sequence. It is produced with a C-terminal 6xHis tag.
Physical Appearance
Sterile, filtered, white lyophilized powder.
Formulation
The CDH1 protein was subjected to lyophilization from a 0.2 μm filtered solution in phosphate-buffered saline (PBS) at a pH of 7.4.
Solubility
To reconstitute the lyophilized CDH1 protein, it is recommended to dissolve it in sterile 18 MΩ·cm H₂O at a concentration of at least 100 μg/ml. This solution can then be further diluted in other aqueous solutions as needed.
Stability
Lyophilized E-Cadherin demonstrates stability at room temperature for a period of 3 weeks; however, for long-term storage, it is recommended to store it in a desiccated state below -18°C. After reconstitution, CDH1 should be stored at 4°C for a period of 2 to 7 days. For extended storage, it is advisable to store it below -18°C. The addition of a carrier protein, such as 0.1% HSA or BSA, is recommended for long-term storage. It is essential to avoid repeated freeze-thaw cycles.
Purity
The purity is determined to be greater than 95.0% as assessed by SDS-PAGE.
Synonyms
Epithelial cadherin, E-cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324 antigen, CDH1, CDHE, UVO, ECAD, LCAM, Arc-1, CD324, Cadherin-E.
Source
HEK cells.
Amino Acid Sequence
DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWL
KVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVME
GALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTG
LDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVV
ITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYIL
HVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEP
DTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPV
ATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASAN
WTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCR
KAQPVEAGLQIHHHHHH.

Product Science Overview

Structure and Function

E-Cadherin is composed of an extracellular domain, a transmembrane domain, and a cytoplasmic domain. The extracellular domain mediates homophilic interactions with E-Cadherin molecules on adjacent cells, facilitating cell-cell adhesion . The cytoplasmic domain interacts with catenins, which link E-Cadherin to the actin cytoskeleton, thereby stabilizing cell adhesion and maintaining tissue integrity .

Biological Significance

E-Cadherin is essential for the maintenance of epithelial cell layers by regulating cell adhesion, mobility, and proliferation . It plays a pivotal role in embryonic development, tissue morphogenesis, and the maintenance of tissue architecture . Additionally, E-Cadherin functions as a tumor suppressor, and its loss or dysfunction is associated with increased invasiveness and metastasis in various cancers .

Recombinant E-Cadherin

Recombinant E-Cadherin (Human) expressed in HEK 293 cells is a valuable tool for research and therapeutic applications. HEK 293 cells are human embryonic kidney cells that are commonly used for the production of recombinant proteins due to their high transfection efficiency and ability to perform post-translational modifications .

The recombinant E-Cadherin protein is typically tagged with a 6-His tag at the C-terminus to facilitate purification and detection . It is lyophilized from a filtered solution in PBS, pH 7.4, and can be reconstituted in sterile PBS for use in various assays .

Applications

Recombinant E-Cadherin is widely used in research to study cell adhesion, signaling pathways, and cancer biology. It is also utilized in drug discovery and development, particularly in screening for compounds that modulate E-Cadherin-mediated cell adhesion .

Storage and Handling

The lyophilized recombinant E-Cadherin should be stored at -20°C for long-term preservation. Upon reconstitution, it can be stored at 2-8°C for up to one month . It is important to avoid vortexing the solution to maintain protein integrity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.