WNV Pre-M
Description
The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag at c-terminal.
Product Specs
YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK
ATRYLVKTESWILRNPGYALE.
Purified by proprietary chromatographic technique.
Product Science Overview
West Nile Virus (WNV) is a member of the Flaviviridae family, which includes other significant arthropod-borne viruses such as dengue, tick-borne encephalitis, Japanese encephalitis, and yellow fever viruses . WNV is primarily transmitted through the bite of infected Culex mosquitoes and can infect a wide range of hosts, including birds, mammals, amphibians, and reptiles . Humans and horses are considered dead-end hosts, meaning they do not contribute to the transmission cycle .
The WNV virion is approximately 45-50 nm in diameter and is covered with a relatively smooth protein surface . The virus’s genome encodes three structural proteins: the capsid ©, the membrane (M), and the envelope (E) proteins. The pre-membrane (prM) protein is a precursor to the M protein and plays a crucial role in the virus’s life cycle .
Recombinant technology has been employed to develop various diagnostic and therapeutic tools for WNV. One such approach involves the use of recombinant WNV prM/E proteins. These recombinant proteins are expressed in different systems, such as baculoviruses, to study their immunogenicity and potential as vaccine candidates . For instance, recombinant baculoviruses expressing WNV prM/E proteins have been shown to induce significant levels of WNV-neutralizing antibodies and E protein-specific T-cell responses in animal models .
Recombinant WNV proteins have also been utilized to improve diagnostic assays. Traditional serological tests for WNV are complicated by the high degree of cross-reactivity between antibodies against other flaviviruses . By using recombinant WNV E proteins with specific mutations, researchers have developed assays that can distinguish WNV infections from those caused by other flaviviruses . This advancement is particularly important in regions where multiple flaviviruses co-circulate or in populations immunized with vaccines against other flaviviruses .
The development of effective vaccines against WNV is crucial for controlling its spread and reducing its impact on human and animal health. Recombinant WNV prM/E proteins have shown promise as vaccine candidates in various animal models . For example, a recombinant Newcastle disease virus expressing WNV prM/E proteins has been evaluated for its immunogenicity in mammals and poultry, demonstrating significant levels of WNV-specific antibodies and T-cell responses . Such versatile vaccines, suitable for different species and administration routes, are essential for comprehensive WNV control strategies .
