Tpc1808 Rat

Tropic 1808 Rat Recombinant
Cat. No.
BT26086
Source
Escherichia Coli.
Synonyms
Tropic 1808, Tpc1808.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Usage

THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Shipped with Ice Packs
In Stock

Description

Tropic-1808 Rat Recombinant protein fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa.
The Tpc1808 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Tropic 1808, a potential chemotropic factor, is induced by nerve injury. Similar to nerve growth factor (NGF), Tpc1808 protein can promote the expression of neurofilament heavy chain (NF-H) in a time-dependent manner. Tpc1808 is a gene associated with nerve growth promotion, and both the Tpc1808 gene and its recombinant protein enhance NF-H expression in PC12 cells.
Description
Recombinant Tropic-1808 Rat protein, fused to an N-terminal His-Tag, is produced in E. coli. It is a single, non-glycosylated polypeptide chain comprising 285 amino acids with a molecular weight of 29.1 kDa. Tpc1808 is purified using proprietary chromatographic techniques.
Physical Appearance
Sterile filtered white lyophilized powder.
Formulation
Tropic-1808 was lyophilized in 1X PBS at a pH of 7.4.
Stability
Lyophilized Tpc1808 remains stable at 10°C for up to 1 week; however, it is recommended to store it desiccated below -18°C. Avoid freeze-thaw cycles.
Purity
Purity exceeds 95.0% as determined by: (a) Reverse-phase high-performance liquid chromatography (RP-HPLC) analysis and (b) SDS-PAGE analysis.
Synonyms
Tropic 1808, Tpc1808.
Source
Escherichia Coli.
Amino Acid Sequence
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPS
AGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKL
TIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLS
LNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLS
AAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNF
NLYLIKVKNTWKLMTLLLS.

Product Science Overview

Structure and Production

Tropic 1808 is a single, non-glycosylated polypeptide chain consisting of 285 amino acids, with a molecular mass of approximately 29.1 kDa . The protein is produced in Escherichia coli (E. coli) and is typically fused to an N-terminal His-Tag to facilitate purification . The protein is purified using high-performance liquid chromatography (HPLC) and validated for bioactivity through various assays .

Function and Biological Activity

Tropic 1808 is considered a candidate chemotropic factor, which means it can influence the direction of nerve growth. It is induced by nerve injury and has been shown to promote the expression of neurofilament heavy chain (NF-H) in a time-dependent manner . This activity is similar to that of nerve growth factor (NGF), a well-known protein involved in the growth, maintenance, and survival of neurons .

Applications in Research

Due to its role in promoting nerve growth, Tropic 1808 is used in various research applications, particularly in studies focused on nerve injury and regeneration. It has been shown to up-regulate the expression of NF-H in PC12 cells, a commonly used cell line in neurobiological research . This makes it a valuable tool for understanding the mechanisms of nerve growth and developing potential therapeutic strategies for nerve injuries.

Storage and Handling

Tropic 1808 is typically lyophilized (freeze-dried) and should be stored at temperatures below -18°C to maintain its stability . It is important to avoid freeze-thaw cycles to prevent degradation of the protein. The lyophilized protein is reconstituted in a buffer solution, usually phosphate-buffered saline (PBS) at pH 7.4, before use .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.