RAP Rat

Receptor Associated Protein Rat Recombinant
Cat. No.
BT10731
Source
Escherichia Coli.
Synonyms
Receptor Associated Protein, RAP.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Usage

THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Shipped with Ice Packs
In Stock

Description

Recombinant Rat Receptor Associated Protein produced in E.Coli is a single, non-glycosylated polypeptide chain containing 327 amino acids and having a molecular mass of 38,862 Dalton. The Recombinant RAP Rat contains 6xHis tag and 1xC-myc, RAP Rat is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Receptor-associated Protein (RAP) is known to inhibit the binding of ApoE-containing lipoproteins to receptors of the LDL receptor family. This inhibitory action of RAP has been shown to block the growth-enhancing effects of glial cell line-derived neurotrophic factor (GDNF) on axons. In the presence of RAP, GDNF's ability to stimulate axon growth is neutralized. This finding suggests that the axon growth-promoting effects of apoE-containing lipoproteins, secreted by glial cells, are mediated through receptors of the LDL receptor family, and that RAP can effectively block this interaction.
Description
Recombinant Rat Receptor Associated Protein, expressed in E. coli, is a single, non-glycosylated polypeptide chain. It comprises 327 amino acids, resulting in a molecular mass of 38,862 Daltons. This recombinant protein is engineered with a 6xHis tag and a 1xC-myc tag for detection and purification purposes. The purification process utilizes proprietary chromatographic techniques to ensure high purity.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The protein was lyophilized at a concentration of 1 mg/ml from a sterile solution containing Tris-buffered saline (TBS) at pH 7.5, 0.1% bovine serum albumin (BSA), and 0.09% sodium azide (NaN3).
Note
RAP's ligand binding is calcium-dependent. To dissociate lipid receptors from RAP, a buffer containing 10mM EDTA can be used. Buffers containing phosphate should be avoided as they may lead to precipitation with calcium ions.
Solubility
To reconstitute the lyophilized RAP Rat, it is recommended to dissolve it in sterile 18 megaohm-centimeter (MΩ·cm) H2O at a concentration of at least 100 micrograms per milliliter (µg/ml). This solution can be further diluted in other aqueous solutions as needed.
Stability
Lyophilized RAP Rat, while stable at room temperature for up to 3 weeks, should be stored desiccated at a temperature below -18°C. Once reconstituted, RAP Rat should be stored at 4°C for 2-7 days. For long-term storage, it is recommended to store it below -18°C. To ensure stability during long-term storage, consider adding a carrier protein such as 0.1% human serum albumin (HSA) or BSA. Avoid repeated freeze-thaw cycles.
Purity
The purity of this product is determined to be greater than 95% as assessed by SDS-PAGE analysis.
Synonyms
Receptor Associated Protein, RAP.
Source
Escherichia Coli.
Amino Acid Sequence
MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL.

Product Science Overview

Structure and Production

Recombinant Rat Receptor Associated Protein is produced in Escherichia coli (E. coli) and is a single, non-glycosylated polypeptide chain. It consists of 327 amino acids and has a molecular mass of approximately 38,862 Daltons . The recombinant version often includes tags such as 6xHis and 1xC-myc for purification purposes .

Function and Mechanism

RAP functions by binding to LDLR family members, preventing their premature interaction with ligands within the endoplasmic reticulum (ER). This ensures that the receptors are correctly folded and transported to their proper cellular locations. One of the key roles of RAP is to avert the glial cell-mediated (GCM) enhancement of axon growth by ApoE-containing lipoproteins . In the presence of RAP, the growth stimulatory effect of these lipoproteins is annulled, indicating that the effect is mediated by LDLR family receptors .

Applications in Research

Recombinant RAP is widely used in laboratory research to study receptor-ligand interactions, receptor trafficking, and the molecular mechanisms underlying various cellular processes. It is particularly useful in experiments involving the LDLR family, as it can be used to block receptor-ligand interactions and study the resulting effects on cellular functions .

Physical Properties and Storage

The recombinant protein is typically provided as a sterile, lyophilized (freeze-dried) powder. It is recommended to reconstitute the lyophilized RAP in sterile water to a concentration of at least 100 µg/ml, which can then be further diluted for use in various experimental setups . The protein is stable at room temperature for up to three weeks when lyophilized, but for long-term storage, it should be kept desiccated below -18°C. Once reconstituted, it should be stored at 4°C for short-term use (2-7 days) and below -18°C for long-term storage .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.