Pramlintide

Pramlintide
Cat. No.
BT17153
Source
Synonyms
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 98.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2.

Product Specs

Introduction
Pramlintide acetate is a synthetic hormone that mimics the effects of amylin, a naturally occurring hormone produced by the pancreas. It is used in conjunction with insulin to manage blood sugar levels in individuals with type 1 and type 2 diabetes. Pramlintide works by slowing gastric emptying, suppressing glucagon secretion, and promoting a sense of fullness, which helps regulate blood glucose levels.
Description
Pramlintide Synthetic is a polypeptide composed of 37 amino acids, with a molecular weight of 3949.4 Daltons. Its chemical formula is C171H267N51O53S2. It is a non-glycosylated molecule, meaning it lacks attached carbohydrate groups.
Physical Appearance
Pramlintide Synthetic is supplied as a sterile, white powder that has been freeze-dried.
Formulation
The Pramlintide Synthetic is provided in a lyophilized form without any additional excipients or stabilizers.
Solubility
To reconstitute lyophilized Pramlintide, it is recommended to dissolve it in sterile 18 MΩ-cm H2O to a concentration of at least 100 µg/ml. This solution can be further diluted using other aqueous solutions as needed. Pramlintide is also soluble in a 1% acetic acid solution.
Stability
Lyophilized Pramlintide remains stable at room temperature for up to 3 weeks; however, for extended storage, it is recommended to store it in a desiccated state below -18°C. After reconstitution, Pramlintide can be stored at 4°C for 2 to 7 days. For long-term storage, freezing below -18°C is recommended, and the addition of a carrier protein like 0.1% HSA or BSA is advised. Repeated freezing and thawing should be avoided.
Purity
The purity of Pramlintide Synthetic is greater than 98.0%, as determined by two analytical methods: Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) and Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis (SDS-PAGE).
Amino Acid Sequence

KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.

Product Science Overview

Development and Approval

Pramlintide was developed by Amylin Pharmaceuticals as an adjunct treatment for diabetes, specifically for individuals with type 1 and type 2 diabetes who are already using insulin but require additional glycemic control . It was approved by the U.S. Food and Drug Administration (FDA) on March 16, 2005 .

Mechanism of Action

Pramlintide mimics the effects of amylin by modulating the rate of gastric emptying, preventing postprandial (after meal) spikes in blood glucose levels, and increasing feelings of fullness, which can help reduce caloric intake and promote weight loss . This makes it particularly beneficial for individuals who struggle with postprandial hyperglycemia and weight management.

Clinical Use

Pramlintide is administered via subcutaneous injection before meals. It is used in conjunction with insulin therapy to improve overall glycemic control. By allowing patients to use less insulin, pramlintide helps lower average blood sugar levels and reduces the risk of large, unhealthy spikes in blood glucose that can occur after eating .

Benefits and Considerations

The use of pramlintide has been shown to provide several benefits, including:

  • Improved glycemic control
  • Reduced postprandial glucose excursions
  • Enhanced satiety and potential weight loss

However, it is important to note that pramlintide therapy requires careful management and patient education to avoid potential side effects such as hypoglycemia (low blood sugar) and gastrointestinal symptoms .

Pramlintide represents a significant advancement in the management of diabetes, offering an additional tool for patients and healthcare providers to achieve better glycemic control and improve overall quality of life.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.