Omp Pylori

Helicobacter Pylori Outer Membrane Protein Recombinant
Cat. No.
BT19504
Source
E.Coli
Synonyms
Appearance
Sterile filtered liquid formulation.
Purity
Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.

Product Specs

Introduction
Helicobacter pylori is a Gram-negative, microaerophilic bacterium found in the stomach, particularly the antrum. It causes chronic inflammation of the stomach lining and is strongly linked to duodenal and gastric ulcers and stomach cancer. Affecting over half of the global population, H. pylori infection is more common in developing nations. Currently, there is no perfect target antigen for diagnosing H. pylori. However, a 23 kDa outer membrane protein has shown promise with good sensitivity and coverage in diagnosing H. pylori infection.
Description
Recombinant Omp Pylori antigen is produced in E. coli, expressing the H. pylori 23 kDa outer membrane protein. This recombinant antigen is effectively recognized by IgG and IgM antibodies from H. pylori infected patients.
Physical Appearance
Sterile, filtered liquid.
Formulation
The recombinant Omp Pylori protein is prepared in 1xPBS with a pH of 7.4.
Stability
While Omp Pylori remains stable at 4°C for up to one week, it is recommended to store it below -18°C. Avoid repeated freeze-thaw cycles.
Purity
Purity exceeds 95% as determined by 12% SDS-PAGE analysis with Coomassie blue staining.
Source
E.Coli
Amino Acid Sequence
MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWP
KDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWK
NTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLI
DKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCP
AGWRKGDKGMKATHQGVAEYLKENSIKL.
Purification Method
Purified by proprietary chromatographic technique.

Product Science Overview

Introduction

Helicobacter pylori is a Gram-negative, microaerophilic bacterium that primarily colonizes the human stomach. It is known for its helical shape and high motility, which is facilitated by its flagella. This bacterium is a significant human pathogen, infecting over half of the world’s population. While many infections are asymptomatic, H. pylori is a recognized risk factor for various gastric disorders, including gastritis, peptic ulcers, and gastric cancer .

Outer Membrane Proteins (OMPs)

The outer membrane of H. pylori is a critical component of its structure and function. It consists of two highly asymmetric layers: the inner monolayer contains phospholipids, while the outer monolayer is composed mainly of outer membrane proteins (OMPs). These OMPs play a crucial role in the bacterium’s ability to adapt to the gastric environment and facilitate infection .

Virulence Factors

H. pylori’s pathogenicity is largely attributed to its virulence factors, including CagA and VacA, as well as its OMPs. These proteins help the bacterium adhere to gastric epithelial cells, colonize the stomach, and evade the host immune response. Some of the well-studied OMPs include BabA (HopS), SabA (HopP), OipA (HopH), HopQ, and HopZ .

Recombinant Outer Membrane Proteins

Recombinant outer membrane proteins of H. pylori are produced using genetic engineering techniques. These proteins are expressed in a host organism, such as Escherichia coli, and then purified for use in research and potential therapeutic applications. The recombinant proteins are used to study the structure, function, and immunogenicity of H. pylori OMPs. They are also being investigated as potential targets for novel therapies and vaccines .

Importance in Research and Medicine

Understanding the role of H. pylori OMPs in the bacterium’s pathogenicity is essential for developing new strategies to combat H. pylori-related diseases. Research on recombinant OMPs has provided valuable insights into the mechanisms of H. pylori infection and its interactions with the host. These studies have also highlighted the potential of OMPs as targets for therapeutic interventions and vaccine development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.