MX1 Bovine
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Description
The MX1 is purified by proprietary chromatographic techniques.
Product Specs
LIDSLRSLGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRLKKLGNE
DEWKGKVSFLDKEIEIPDASQVEKEISEAQIAIAGEGTGISHELISLEVSSPHVPDLTLIDLP
GITRVAVGNQPPDIEYQIKSLIRKYILRQETINLVVVPANVDIATTEALRMAQEVDPQGDRTI
GILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQDIKHRMSLDKALQRERIFFEDH
AHFRDLLEEGKATIPCLAERLTSELIMHICKTLPLLENQIKETHQRITEELQKYGKDIPEEES
EKMFCLIEKIDTFNKEIISTIEGEEFVEQYDSRLFTKVRAEFSKWSAVVEKNFEKGYEAIRKE
IKQFENRYRGRELPGFVNYKTFETIIKKQVRVLEEPAVDMLHTVTDIIRNTFTDVSGKHFNEF
FNLHRTAKSKIEDIRLEQENEAEKSIRLHFQMEQLVYCQDQVYRRALQQVREKEAEEEKNKKS
NHYFQSQVSEPSTDEIFQHLTAYQQEVSTRISGHIPLIIQFFVLRTYGEQLKKSMLQLLQDKD
QYDWLLKERTDTRDKRKFLKERLERLTRARQRLAKFPG.
Product Science Overview
Myxovirus Resistance 1 (Mx1) is a protein that plays a crucial role in the innate immune response against viral infections. It is part of the interferon-induced GTPase family and is known for its antiviral properties. The Mx1 protein is highly conserved across various species, including humans, mice, and bovines. The recombinant form of this protein, specifically the bovine variant, has been studied for its potential applications in veterinary medicine and research.
Mx1 is a dynamin-like GTPase that interferes with the replication of a wide range of RNA viruses. The protein is induced by type I interferons and is known to inhibit the replication of viruses such as influenza, vesicular stomatitis virus, and Thogoto virus. The bovine Mx1 protein consists of 668 amino acids and has a molecular mass of approximately 77 kDa .
The antiviral activity of Mx1 is primarily attributed to its ability to bind and hydrolyze GTP, which is essential for its function. Upon activation by interferons, Mx1 translocates to the cytoplasm, where it forms oligomers and interacts with viral nucleocapsids. This interaction prevents the transport of viral ribonucleoproteins into the nucleus, thereby inhibiting viral replication.
The recombinant bovine Mx1 protein is produced using advanced chromatographic techniques. The protein is typically expressed in bacterial or mammalian cell systems and purified to high purity levels. The lyophilized form of the protein is often used in research and diagnostic applications. For instance, the recombinant Mx1 protein is lyophilized from a solution containing Tris-HCl, NaCl, Imidazole, DTT, and urea .
The recombinant bovine Mx1 protein has several applications in research and veterinary medicine. It is used as a biomarker for studying the immune response in cattle and other animals. Additionally, it is employed in the development of diagnostic assays for detecting viral infections. The protein’s antiviral properties also make it a potential candidate for therapeutic interventions against viral diseases in livestock.
