MECP2 Human

Methyl CpG Binding Protein 2 Human Recombinant
Cat. No.
BT23686
Source
Mammalian system, 293 cells.
Synonyms
Methyl CpG binding protein 2 (Rett syndrome), MeCp-2 protein, AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTT, Mental retardation, X-linked 16, DKFZp686A24160.
Appearance
Sterile Filtered colorless solution.
Purity
Greater than 80% as determined by SDS-PAGE.
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

MECP2 Human Recombinant is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa.

Product Specs

Introduction
MECP2 is a critical regulator of gene expression in mammals and plays a vital role in development. This protein belongs to a family of methyl-CpG binding domain (MBD) proteins, including MBD1, MBD2, MBD3, and MBD4. Except for MBD3, these proteins can bind to methylated DNA sequences. MECP2, MBD1, and MBD2 also repress transcription from methylated promoters. Notably, MECP2 is located on the X chromosome and undergoes X inactivation. While dispensable in stem cells, MECP2 is essential for embryonic development. Mutations in the MECP2 gene are the primary cause of Rett syndrome, a neurodevelopmental disorder primarily affecting females and a leading cause of intellectual disability.
Description
Recombinant human MECP2, with an N-terminal Flag tag, was expressed in a 293 cell expression system. The protein encompasses amino acids 1 to 486 and has a molecular weight of 53.56 kDa.
Physical Appearance
Clear, colorless, and sterile-filtered solution.
Formulation
The MECP2 solution is provided at a concentration of 0.45 mg/ml in a buffer consisting of 50 mM Tris, 135 mM NaCl, 20% glycerol, pH 7.5, and 200 µg/ml FLAG peptide.
Stability
MECP2 demonstrates stability for 4 weeks when stored at 4°C. For extended storage, it is advisable to store the protein below -18°C with the addition of a carrier protein such as HSA or BSA at a concentration of 0.1%. Repeated freeze-thaw cycles should be avoided.
Purity
The purity of MECP2 is determined to be greater than 80% using SDS-PAGE analysis.
Synonyms
Methyl CpG binding protein 2 (Rett syndrome), MeCp-2 protein, AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTT, Mental retardation, X-linked 16, DKFZp686A24160.
Source
Mammalian system, 293 cells.
Amino Acid Sequence
MDYKDDDDKMVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSA
EPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAG
KYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGT
GRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMV
IKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIE
VKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVP
LLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAA
EKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS.

Product Science Overview

Introduction

Methyl CpG Binding Protein 2 (MECP2) is a critical protein involved in the regulation of gene expression through its interaction with methylated DNA. This protein is encoded by the MECP2 gene, which is located on the X chromosome in humans. MECP2 plays a significant role in the development and function of the nervous system, and its dysfunction is associated with several neurological disorders, most notably Rett syndrome.

Structure and Function

MECP2 contains a methyl-CpG-binding domain (MBD) that allows it to specifically bind to methylated CpG dinucleotides in the DNA. This binding is crucial for the protein’s role in gene regulation. MECP2 can act as both a transcriptional repressor and activator, depending on the context. It interacts with other proteins to form complexes that can either silence or activate gene expression .

Role in the Nervous System

MECP2 is highly expressed in mature neurons and is essential for their normal function. It is involved in the maturation of the central nervous system and the formation of synaptic contacts. The protein’s ability to regulate gene expression is vital for neuronal development and plasticity .

MECP2 and Rett Syndrome

Mutations in the MECP2 gene are the primary cause of Rett syndrome, a severe neurological disorder that predominantly affects females. Rett syndrome is characterized by normal early development followed by a loss of acquired skills, motor abnormalities, and cognitive impairment. Over 50 different mutations in the MECP2 gene have been identified in individuals with Rett syndrome .

Human Recombinant MECP2

Human recombinant MECP2 is produced using recombinant DNA technology, where the MECP2 gene is inserted into an expression system, such as insect cells, to produce the protein. This recombinant protein is often tagged with a His-tag to facilitate purification using techniques like Fast Protein Liquid Chromatography (FPLC). Human recombinant MECP2 retains the ability to bind methylated CpG sequences and can be used in various research applications to study its function and role in gene regulation .

Research and Applications

Research on MECP2 has provided significant insights into the mechanisms of gene regulation and the pathogenesis of Rett syndrome. Studies have shown that MECP2 is involved in the regulation of multiple genes and is crucial for maintaining the normal function of neurons. The availability of human recombinant MECP2 has enabled researchers to conduct detailed studies on its structure, function, and interactions with other proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.