MCP 4 Human

Monocyte Chemotactic Protein-4 Human Recombinant (CCL13)
Cat. No.
BT17938
Source
Escherichia Coli.
Synonyms
Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCYL1, SCYA13, MGC17134.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 96.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Monocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 75 amino acids and having a molecular mass of 8.6 kDa. The MCP-4 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Chemokine (C-C motif) ligand 13 (CCL13 / MCP-4) is a small cytokine that belongs to the CC chemokine family. This chemokine is found on chromosome 17 in humans, within a cluster of other CC chemokines. MCP-4 binds to cell surface chemokine receptors such as CCR2, CCR3, and CCR5, which induces chemotaxis in monocytes, eosinophils, T lymphocytes, and basophils. It plays a role in allergic reactions, including asthma. The production of MCP-4 can be induced by inflammatory cytokines such as interleukin-1 and TNF-α.
Description
Recombinant Human Monocyte Chemotactic Protein-4 is produced in E. coli. It is a non-glycosylated polypeptide chain containing 75 amino acids with a molecular mass of 8.6 kDa. This MCP-4 protein is purified using proprietary chromatographic techniques.
Physical Appearance
White, lyophilized powder, sterile-filtered.
Formulation
The protein is lyophilized from a sterile solution of 20mM PB, pH 7.4, and 130mM NaCl at a concentration of 1 mg/ml.
Solubility
Reconstitute the lyophilized MCP-4 in sterile 18M-cm H2O to a concentration of at least 100 µg/ml. This solution can be further diluted with other aqueous solutions.
Stability
Lyophilized MCP-4 remains stable at room temperature for 3 weeks; however, it should be stored desiccated at -18°C or below. After reconstitution, MCP-4 should be stored at 4°C for 2-7 days. For long-term storage, add a carrier protein (0.1% HSA or BSA). Avoid freeze-thaw cycles.
Purity
Purity exceeds 96.0% as determined by: (a) Reverse-phase high-performance liquid chromatography (RP-HPLC) analysis and (b) SDS-PAGE analysis.
Biological Activity
Specific activity is measured as the ability of MCP-4 to chemoattract human monocytes at a concentration of 10-100 ng/ml, which corresponds to a specific activity of 10,000-100,000 units/mg.
Synonyms
Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCYL1, SCYA13, MGC17134.
Source
Escherichia Coli.
Amino Acid Sequence
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAV
IFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.

Product Science Overview

Induction and Expression

CCL13 is induced by inflammatory proteins such as interleukin-1 (IL-1) and tumor necrosis factor-alpha (TNF-alpha) . The gene encoding CCL13 is located on human chromosome 17, within a large cluster of other CC chemokines . This clustering suggests a coordinated regulation and function of these chemokines in immune responses.

Receptors and Signaling

CCL13 functions by binding to three different G protein-coupled receptors: CCR2, CCR3, and CCR5 . These receptors are expressed on the surface of target cells and mediate the chemotactic response, leading to the directed movement of immune cells towards the site of inflammation or infection . This signaling is particularly important in the context of allergic responses and other inflammatory conditions.

Biological Activity

The biological activity of CCL13 includes the induction of chemotaxis in monocytes, eosinophils, T lymphocytes, and basophils . This chemotactic activity is essential for the recruitment of these immune cells to sites of inflammation, where they can exert their effector functions. The ability of CCL13 to attract a diverse range of immune cells highlights its importance in coordinating the immune response.

Recombinant Production

Human recombinant CCL13 is produced using an expression system in Escherichia coli (E. coli) . The recombinant protein is purified to a high degree of purity, typically greater than 98%, and is free from endotoxins . This high level of purity is essential for its use in research applications, where it is used to study the chemotactic properties and signaling mechanisms of CCL13.

Applications in Research

Recombinant CCL13 is widely used in various research applications, including Western blotting, enzyme-linked immunosorbent assay (ELISA), and functional assays . These applications help researchers to understand the role of CCL13 in immune responses and to explore its potential as a therapeutic target in inflammatory and allergic diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.