LGALS13 Human
Description
Recombinant Human LGALS13 produced in E.Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 16kDa. The LGALS13 also might appear as a homodimer, having a total Mw of 32kDa. LGALS13 is fused to a 6xHis tag at n-terminal and purified using standard chromatography techniques.
Product Specs
MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDM DEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGK
QFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Product Science Overview
Galectins are a family of carbohydrate-binding proteins that play crucial roles in various physiological and pathological processes. They are characterized by their affinity for β-galactoside residues and are involved in inflammation, immune responses, cell migration, autophagy, and signaling . Galectins are synthesized as cytosolic proteins and can interact with both carbohydrate and non-carbohydrate binding partners .
Galectins were initially discovered due to their galactoside-binding activity. They were defined as a protein family based on conserved β-galactoside-binding sites within their characteristic carbohydrate recognition domains (CRDs), which are approximately 130 amino acids long . The galectin family has evolved through tandem and en-mass genome duplications, resulting in over 15 known vertebrate galectins .
Galectin-13, also known as placental protein 13 (PP13), is a member of the galectin family. It is predominantly expressed in the placenta and has been implicated in various reproductive processes. Galectin-13 is involved in the regulation of immune responses at the maternal-fetal interface, promoting immune tolerance and contributing to successful pregnancy outcomes .
Galectin-13 has several important functions:
- Immune Modulation: Galectin-13 modulates immune responses by interacting with immune cells and influencing cytokine production. It promotes the differentiation of regulatory T cells and suppresses the activation of effector T cells, thereby contributing to immune tolerance during pregnancy .
- Angiogenesis: Galectin-13 plays a role in angiogenesis, the formation of new blood vessels, which is essential for placental development and function. It promotes the proliferation and migration of endothelial cells, facilitating the establishment of a functional placental vasculature .
- Apoptosis: Galectin-13 can induce apoptosis, or programmed cell death, in certain cell types. This function is important for maintaining tissue homeostasis and preventing excessive inflammation .
Recombinant Galectin-13 has several potential applications:
- Research: Recombinant Galectin-13 is used in research to study its functions and mechanisms in various biological processes. It serves as a valuable tool for investigating the role of galectins in immune regulation, angiogenesis, and apoptosis .
- Therapeutics: Due to its immunomodulatory and angiogenic properties, recombinant Galectin-13 holds promise as a therapeutic agent for conditions such as preeclampsia, a pregnancy complication characterized by high blood pressure and organ damage .
