IL-12 Human

Interleukin-12 Human Recombinant
Cat. No.
BT8258
Source
HEK.
Synonyms
NKSF, CTL maturation factor (TCMF), Cytotoxic lymphocyte maturation factor (CLMF), TSF, Edodekin-alpha, IL-12.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95% as obsereved by SDS-PAGE.
Usage
THE BioTeks products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Interleukin-12 Human Recombinant produced in HEK cells is a glycosylated heterodimer, having a total molecular weight of 57kDa.
The IL12 is purified by proprietary chromatographic techniques.

Product Specs

Introduction

Interleukin-12 (IL-12) is a heterodimeric cytokine with a critical role in cell-mediated immunity. It stimulates the production of interferon-gamma (IFN-γ) from T cells and natural killer (NK) cells and promotes the differentiation of T helper 1 (Th1) cells.

Description
Recombinant human Interleukin-12, produced in HEK cells, is a glycosylated heterodimer with a molecular weight of 57 kDa. It undergoes purification using proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The IL-12 product was lyophilized from a 0.2 μm filtered solution containing 1x phosphate-buffered saline (PBS).
Solubility
For reconstitution of lyophilized IL-12, sterile PBS containing 0.1% endotoxin-free recombinant human serum albumin (HSA) is recommended.
Stability
Lyophilized IL-12, while stable at room temperature for up to 3 weeks, should ideally be stored desiccated below -18°C. After reconstitution, store IL-12 at 4°C for 2-7 days. For long-term storage, freeze at -18°C. The addition of a carrier protein (0.1% HSA or BSA) is recommended for long-term storage. Avoid repeated freeze-thaw cycles.
Purity
Purity greater than 95% as determined by SDS-PAGE analysis.
Biological Activity
The specific activity, determined by the dose-dependent release of IFN-γ from the human NK92 cell line in the presence of 20 ng/mL recombinant IL-2, has an EC50 of 0.5 ng/mL.
Synonyms
NKSF, CTL maturation factor (TCMF), Cytotoxic lymphocyte maturation factor (CLMF), TSF, Edodekin-alpha, IL-12.
Source
HEK.
Amino Acid Sequence

IL-12 is a heterodimer of IL-12A and IL-12B linked through a disulfide-bond between cysteines in red in sequences below.
>IL-12 A
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP
LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ
IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS.
>IL-12B
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAG
QYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTD
LTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAV
HKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGK
SKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS.


Product Science Overview

Introduction

Interleukin-12 (IL-12) is a heterodimeric cytokine composed of two subunits, p35 and p40, which are linked by disulfide bonds . This cytokine plays a crucial role in the regulation of immune responses, particularly in the differentiation of naive T cells into Th1 cells and the activation of natural killer (NK) cells .

Structure and Production

IL-12 is a 70 kDa cytokine that is produced by various immune cells, including monocytes, macrophages, dendritic cells, neutrophils, and B cells . The recombinant form of human IL-12 (rHuIL-12) is typically produced in Chinese hamster ovary (CHO) cells that have been transfected with a fusion gene encoding the p35 and p40 subunits . This recombinant cytokine is biologically active and can be used in various research and therapeutic applications.

Biological Functions

IL-12 is known for its pleiotropic effects on the immune system. It stimulates the production of interferon-gamma (IFN-γ) by NK and T cells, which in turn enhances the cytotoxic activity of these cells . IL-12 also promotes the proliferation of T cells and the differentiation of CD4+ T cells into Th1 cells, which are essential for cell-mediated immunity .

Clinical Applications

Recombinant human IL-12 has been investigated for its potential therapeutic applications in various diseases. It has shown promise as an adjuvant therapy in cancer treatment due to its ability to enhance the immune response against tumor cells . Additionally, rHuIL-12 is being developed as a medical countermeasure for the hematopoietic syndrome of acute radiation syndrome (HSARS), which occurs in individuals exposed to lethal radiation .

Safety and Efficacy

Clinical studies have demonstrated that low doses of rHuIL-12 can safely trigger hematopoietic and immune-mediated effects without causing significant toxicity . Common adverse events associated with rHuIL-12 administration include headache, dizziness, and chills . The cytokine’s elimination is biphasic, indicating significant distribution into extravascular spaces .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.