IBV-NP
E. coli.
Sterile Filtered clear solution.
Description
Recombinant Influenza B Virus Nucleoprotein produced in E. coli having a Mw of 76.8kDa. IBV-NP is fused to a 6xHis tag at its C terminal is and purified by proprietary chromatographic technique.
Product Specs
E. coli.
HMSNMDIDGMNTGTIDKTPEEITSGTSGTTRPIIRPATLAPPSNKRTRNPSPDRTTTSSE
DDVGRKAQKKQTPTEIKKSVYNMVVKLGEFYNQMMVKAGLNDDMERNLIQNAHAVERILL
AATDDKKTEFQKKKNARDVKEGKEEIDHNKTGGTFYKMVRDDKTIYFSPIRITFLKEEVKT
MYKTTMGSDGFSGLNHIMIGHSQMNDVCFQRSKALKRVGLDPSLISTFAGSTVPRRSGATGV
AIKGGGTLVAEAIRFIGRAMADRGLLRDIKAKTAYEKILLNLKNKCSAPQQKALVDQVIGSRN
PGIADIEDLTLLARSMVVVRPSVASKVVLPISIYAKIPQLGFNVEEYSMVGYEAMALYNMATP
VSILRMGDDAKDKSQLFFMSCFGAAYEDLRVLSALTGTEFKPRSALKCKGFHVPAKEQVEGMGA
ALMSIKLQFWAPMTRSGGNEVGGDGGSGQISCSPVFAVERPIALSKQAVRRMLSMNIEGRDADV
KGNLLKMMNDSMAKKTSGNAFIGKKMFQISDKNKTNPIEIPIKQTIPNFFFGRDTAEDYDDLDYLE.
Product Science Overview
Influenza B virus (IBV) is a significant cause of seasonal flu epidemics, affecting millions of people worldwide each year. Unlike Influenza A, which can infect multiple species, Influenza B primarily infects humans, making it a critical target for vaccine development and antiviral research. One of the key components in the study of IBV is the nucleoprotein (NP), which plays a crucial role in the virus’s replication and host adaptation.
The nucleoprotein (NP) of Influenza B virus is a multifunctional protein that encapsidates the viral RNA genome, protecting it from nucleases and forming the ribonucleoprotein (RNP) complex . This complex is essential for the transcription and replication of the viral genome. The NP contains two nuclear localization signals (NLSs), which facilitate the transport of the RNP complex into the nucleus of the host cell .
Recombinant nucleoproteins are artificially produced proteins that mimic the natural nucleoproteins of the virus. These recombinant proteins are typically expressed in host cells, such as baculovirus-insect cells, to ensure high yield and purity . The recombinant Influenza B nucleoprotein is often tagged with a polyhistidine tag to facilitate purification and detection .
Recombinant Influenza B nucleoprotein is a valuable tool in virology research. It allows scientists to study the structure and function of the NP in detail, providing insights into the mechanisms of viral replication and host adaptation. Additionally, recombinant NPs are used in the development of diagnostic assays and vaccines. By understanding how the NP interacts with the host cell machinery, researchers can design more effective antiviral drugs and vaccines .
Recombinant proteins, including Influenza B nucleoprotein, are typically lyophilized (freeze-dried) to ensure stability during storage and transport . These proteins are stable for up to twelve months when stored at -20°C to -80°C under sterile conditions. It is important to avoid repeated freeze-thaw cycles to maintain the protein’s integrity .
