IAV-NP

Influenza A Virus Nucleoprotein Recombinant
Cat. No.
BT27090
Source

E. coli.

Synonyms
Appearance

Sterile Filtered clear solution.

Purity

Protein is >90% pure as determined by 10% PAGE (coomassie staining).      

Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Recombinant Influenza A Virus Nucleoprotein produced in E. coli having a Mw of 66.6kDa. IAV-NP is fused to a 6xHis tag at its C terminal is and purified by proprietary chromatographic technique.

Product Specs

Description
Recombinant Influenza A Virus Nucleoprotein (IAV-NP), with a molecular weight of 66.6 kDa, is produced in E. coli. This protein is engineered with a C-terminal 6xHis tag and purified using a proprietary chromatographic technique.
Physical Appearance
Sterile Filtered clear solution.
Formulation
The IAV-NP protein solution is formulated in PBS containing 0.25% sodium azide and 10mM K2CO3.
Stability
For short-term storage (2-4 weeks), the protein can be stored at 4°C. For extended storage, freeze at -20°C. Adding a carrier protein (0.1% HSA or BSA) is recommended for long-term storage. Avoid repeated freeze-thaw cycles.
Purity
The protein purity exceeds 90% as determined by 10% SDS-PAGE analysis with Coomassie blue staining.
Source

E. coli.

Amino Acid Sequence

MASQGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGR LIQNSLTIERMVLSAFDERRNRYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELVL YDKEEIRRIWR QANNGDDATRGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMC SLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMIKRGINDRNFWRGENGRKTRSAY ERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFSARSALILRGSVAHKS CLPACVYGPAVSSGYDFEKEGYSLVGIDPFKLLQNSQVYSLIRPNENPAHKSQLVWM ACHSAAFEDLRLLSFIRGTKVCPRGKLSTRGVQIASNENMDNMESSTLELRSRYWAIR TRSGGNTNQQRASAGQISVQPTFSVQRNLPFEKSTVMAAFTGNTEGRTSDMRAEIIRMM

Product Science Overview

Introduction

The Influenza A virus nucleoprotein (NP) is a critical component of the viral replication machinery. It plays a multifaceted role in the virus’s life cycle, including encapsidating the viral RNA genome and interacting with host cell machinery to facilitate viral replication and transcription. Recombinant nucleoprotein is a form of this protein that is produced through recombinant DNA technology, allowing for its use in various research and therapeutic applications.

Structure and Function

The nucleoprotein of Influenza A virus is a highly conserved protein among different strains of the virus. It consists of approximately 498-501 amino acids and has a molecular mass of around 56.7 kDa . The NP forms large, RNA-bound, helical filaments and acts as a scaffold for additional viral proteins . It contains two nuclear localization signals (NLSs) that are crucial for its function: a well-studied monopartite NLS1 and a less-characterized bipartite NLS2 .

Role in Viral Replication

The NP is essential for the replication and transcription of the viral RNA genome. It encapsidates the viral RNA, forming ribonucleoprotein (RNP) complexes that are necessary for the synthesis of viral RNA. The NP also interacts with the viral polymerase complex, facilitating the transcription and replication of the viral genome .

Recombinant Nucleoprotein Production

Recombinant nucleoprotein can be produced using various expression systems, including Escherichia coli and baculovirus-insect cell systems . The recombinant protein is often tagged with polyhistidine to facilitate purification. For example, a DNA sequence encoding the NP from the Influenza A virus (A/Puerto Rico/8/34/Mount Sinai (H1N1)) can be fused with a polyhistidine tag at the C-terminus and expressed in baculovirus-insect cells . The resulting protein can be purified and used for various applications, including vaccine development and diagnostic assays.

Applications
  1. Vaccine Development: Recombinant NP has been explored as a potential candidate for universal influenza vaccines. Studies have shown that NP-based vaccines can elicit robust immune responses and provide cross-protection against different influenza strains .
  2. Diagnostic Assays: Recombinant NP is used in serological assays to detect antibodies against Influenza A virus in clinical samples. These assays are crucial for diagnosing influenza infections and monitoring immune responses to vaccination.
  3. Research: Recombinant NP is widely used in research to study the molecular mechanisms of influenza virus replication and host interactions. It serves as a valuable tool for investigating the structure-function relationships of viral proteins and developing antiviral therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.