HPV 18
Description
The Recombinant HPV-18 is a full length large capsid protein having an Mw of 55kDa expressed in E. coli and fused to a GST-Tag at n-terminal, having a total Mw of 78kDa, purified by standard chromatography.
Product Specs
NKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVE
IGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQ
LCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTG
YGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRRE
QLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTS
DSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSP
VPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSIL
EDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWN
VDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA.
Product Science Overview
Human Papillomavirus (HPV) is a group of non-enveloped, double-stranded DNA viruses that infect epithelial cells of the skin or mucosa . Among the various genotypes of HPV, types 16 and 18 are highly oncogenic and are most frequently associated with cervical cancer . HPV-18, in particular, is detected in about 17% of cervical cancer cases .
HPV infection is a central causal factor for the development of cervical cancer . Persistent infection with high-risk HPV types, such as HPV-18, is a precursor event to cervical cancer . The time from occurrence of HPV infection to cancer development usually exceeds 20 years . However, other factors such as smoking, long-term use of oral contraceptives, or high parity may also contribute to the development of cervical carcinoma .
Recombinant HPV-18 refers to the use of recombinant DNA technology to produce the L1 protein of HPV-18 . The L1 protein is the major capsid protein of the virus and is capable of self-assembling into virus-like particles (VLPs) that resemble the native virus but are non-infectious . These VLPs are used in vaccines to elicit an immune response without causing disease .
Cervarix is a vaccine that contains purified L1 proteins for HPV types 16 and 18, produced using recombinant DNA technology . The L1 proteins are made by cells into which a gene (DNA) has been introduced, enabling the cells to produce the L1 proteins . The vaccine is adjuvanted and adsorbed to enhance the immune response .
The immune response to HPV infection involves both humoral and cell-mediated immunity . Anti-HPV antibodies are detected in 50 to 70% of infected women and are long-lasting . The recombinant HPV-18 L1 protein in the vaccine induces the production of these antibodies, providing protection against HPV-18 infection .
