HPV 16
Description
The Recombinant HPV-16 antigen is a full length protein expressed in E. coli having an Mw of 56.7kDa. The protein is fused to a GST-Tag, having a total Mw of 82.7kDA and purified by standard chromatography.
Product Specs
This recombinant HPV-16 antigen is a full-length protein produced in E. coli. It has a molecular weight (Mw) of 56.7 kDa and is fused to a GST-Tag, resulting in a total Mw of 82.7 kDa. Purification is achieved through standard chromatography techniques.
This recombinant HPV-16 solution is provided in a buffer containing PBS, 100 mM arginine, and 3 M urea.
IYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSF
YNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECIS
MDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFG
AMDFTTLQANKSEVPLDICTSICKYPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRA
GTVGENVPDDLYIKGSGSTANLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNG
ICWGNQLFVTVVDTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCK
ITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRFVTQAIACQKHTPPAPKED
DPLKKYTFWEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTST
TAKRKKRKL.
Product Science Overview
Human Papillomavirus (HPV) is a highly species-specific virus that can cause squamous epithelial and fibroepithelial tumors in its hosts. Among the various types of HPV, type 16 (HPV 16) is one of the most significant due to its association with malignant hyperproliferation of cells, leading to conditions such as cervical carcinoma .
HPV 16 is classified as a high-risk HPV type, along with types 18, 31, 33, 35, 39, 45, and 52. These high-risk types are responsible for more than 95% of HPV-induced cervical cancer cases . HPV infection is the most common sexually transmitted disease, and vaccination against these high-risk types is considered the most feasible prevention method for cervical cancer .
Recombinant HPV 16 proteins, such as the L1 protein, play a crucial role in the development of prophylactic vaccines. The L1 protein is the major capsid protein of HPV and can self-assemble into virus-like particles (VLPs) when expressed at high levels in eukaryotic or insect cells . These VLPs are immunologically indistinguishable from native virions and are used in vaccines to elicit an immune response without causing infection .
Recombinant HPV 16 L1 protein is typically expressed in baculovirus-insect cell systems or other eukaryotic expression systems. The protein consists of 505 amino acids and has a predicted molecular mass of 56 kDa . It is purified using conventional chromatography techniques to achieve high purity and low endotoxin levels .
The recombinant L1 protein forms the basis of current HPV vaccines, which have shown effectiveness against HPV infection, cervical intraepithelial neoplasia (CIN), and genital warts . These vaccines are type-specific, targeting only a few high-risk HPV types. Clinical trials have demonstrated their efficacy in preventing HPV-related diseases .
