HIV Type-O gp41 13kDa

HIV Type-O gp41 13kDa Recombinant
Cat. No.
BT19831
Source
Escherichia Coli.
Synonyms
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Recombinant HIV-1 gp41 Type-O produced in E.coli is a non-glycosylated polypeptide chain having a molecular mass of 13kDa and fused to a His tag at N-terminus.

Product Specs

Introduction
The human immunodeficiency virus (HIV) is a type of virus known as a retrovirus. It attacks the body's immune system, specifically targeting CD4+ T cells, which are crucial for fighting off infections. As HIV weakens the immune system, the body becomes vulnerable to opportunistic infections. HIV is classified as a lentivirus, a family of viruses known for causing long-term illnesses. These viruses insert their genetic material into the host cell's DNA, allowing them to replicate and potentially remain dormant for extended periods. When active, HIV replicates within infected cells, releasing new virus particles that can infect other cells.
Description
This product consists of a recombinant form of the HIV-1 gp41 protein, specifically the Type-O variant. It has been engineered without glycosylation and includes a His tag fused to its N-terminus. Produced in E. coli, it has a molecular weight of 13kDa.
Physical Appearance
This product appears as a white powder that has been freeze-dried and sterilized by filtration.
Formulation
This product has been lyophilized at a concentration of 1mg/ml in a 20mM Na-carbonate solution at a pH of 9.6.
Solubility
To reconstitute the lyophilized HIV Type-O gp41, it is recommended to dissolve it in sterile 18M-cm H₂O at a minimum concentration of 100µg/ml. This solution can then be further diluted into other aqueous solutions as needed.
Stability
While HIV Type-O gp41 remains stable at room temperature for up to 4 weeks, it is recommended to store it at a temperature below -18°C. To maintain the product's integrity, please avoid repeated freeze-thaw cycles.
Purity
Analysis by SDS-PAGE indicates a purity greater than 95.0%.
Source
Escherichia Coli.
Amino Acid Sequence

MGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ  KAQDQQEQNEKKLLELDE.

Product Science Overview

Introduction to HIV and gp41

Human Immunodeficiency Virus (HIV) is a retrovirus that leads to a condition where the immune system begins to fail, making the body susceptible to opportunistic infections. HIV primarily targets vital cells in the human immune system, such as helper T cells (specifically CD4+ T cells), macrophages, and dendritic cells. The virus was classified as a member of the genus Lentivirus, part of the family Retroviridae .

HIV Type-O

HIV is categorized into different types and groups. HIV Type-O is one of the less common groups of HIV-1, primarily found in West Central Africa. It is distinct from the more prevalent HIV-1 groups M and N. The gp41 protein is a transmembrane glycoprotein that plays a crucial role in the virus’s ability to infect host cells. It is involved in the fusion of the viral membrane with the host cell membrane, facilitating the entry of the viral genome into the host cell .

Recombinant HIV Type-O gp41 13kDa

The recombinant HIV Type-O gp41 13kDa is a non-glycosylated polypeptide chain produced in Escherichia coli (E. coli). It has a molecular mass of 13kDa and is fused to a His tag at the N-terminus. This recombinant protein is used in various research applications, including the study of HIV infection mechanisms and the development of diagnostic tools and vaccines .

Production and Purification

The recombinant HIV Type-O gp41 13kDa is produced using E. coli as the host organism. The gene encoding the gp41 protein is inserted into an expression vector, which is then introduced into E. coli cells. The bacteria are cultured under conditions that promote the expression of the recombinant protein. After expression, the protein is purified using techniques such as affinity chromatography, which exploits the His tag for selective binding and elution .

Applications in Research

The recombinant HIV Type-O gp41 13kDa protein is valuable in various research contexts:

  • Vaccine Development: It is used to study the immune response to HIV and to develop potential vaccines.
  • Diagnostic Tools: The protein can be used in assays to detect antibodies against HIV in patient samples.
  • Mechanistic Studies: Researchers use the protein to investigate the mechanisms of viral entry and fusion with host cells .
Stability and Storage

The recombinant HIV Type-O gp41 13kDa protein is stable at room temperature for up to four weeks but should be stored below -18°C for long-term preservation. It is recommended to avoid repeated freeze-thaw cycles to maintain its stability and functionality .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.