GNLY Human
Description
The GNLY is purified by proprietary chromatographic techniques.
Product Specs
LARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYR
TCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWR
DVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPS
TGPLGSHHHHHH.
Product Science Overview
Granulysin, also known as NKG5 or Lymphokine LAG-2, is a member of the saposin-like protein (SAPLIP) family of membrane-disrupting proteins . It is expressed in the granules of natural killer (NK) cells and activated cytotoxic T lymphocytes (CTLs) . Granulysin exhibits cytolytic activity against a variety of intracellular microbes and tumors, either alone or in synergy with perforin .
Granulysin is initially synthesized as a 15 kDa protein, which is subsequently processed to an active 9 kDa form . The protein is characterized by its ability to disrupt microbial membranes, leading to cell lysis . The recombinant form of granulysin is produced in various expression systems, including bacterial and mammalian cells, to ensure proper folding and post-translational modifications .
The expression of granulysin is tightly regulated at multiple levels, including transcription, alternative splicing, and post-translational processing . In activated lymphocytes, granulysin expression is upregulated in response to cytokines such as interleukin-2 (IL-2) and bacterial antigens . The gene encoding granulysin undergoes extensive alternative splicing, resulting in multiple transcripts, although only a single protein product is typically observed .
Granulysin plays a crucial role in the immune response by targeting and destroying tumor cells, virus-infected cells, and intracellular pathogens . It is known to induce apoptosis in target cells through the activation of various intracellular pathways . Additionally, granulysin has antimicrobial properties, making it effective against a wide range of bacteria, fungi, and parasites .
Recombinant granulysin is widely used in research to study its role in immune responses and its potential therapeutic applications . It has been investigated for its ability to enhance the efficacy of cancer immunotherapies and as a potential treatment for infectious diseases . The recombinant protein is also used in various assays to evaluate its cytolytic activity and to identify potential inhibitors or enhancers of its function .
