CD100 Human HEK
Description
Product Specs
VYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNLTSFKFLG
KNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSF
VFADVIRKSPDSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFL
KARLICSRPDSGLVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSH
GKYMQSTTVEQSHTKWVRYNGPVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSV
TPIDNRPRLIKKDVNYTQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQD
FEPVQTLLLSSKKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQ
TESPSRGLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNSEKTMYLKSSDNRVDHHHHHH.
Product Science Overview
Human recombinant CD100 produced in human embryonic kidney (HEK) cells is a single polypeptide chain containing 721 amino acids (aa 22-734). This recombinant protein is fused to an 8 amino acid His-tag at the C-terminus, which facilitates its purification through chromatographic techniques . The molecular mass of this recombinant protein is approximately 80 kDa.
CD100 is expressed on the surface of various cell types, including T cells, B cells, and dendritic cells. It plays a significant role in the immune system by promoting the activation and differentiation of T cells and B cells. CD100 also enhances the immune response by facilitating the interaction between T cells and antigen-presenting cells.
In the nervous system, CD100 is involved in axonal guidance and neuronal development. It interacts with its receptor, Plexin-B1, to regulate the growth and direction of axons. This interaction is crucial for the proper formation of neural networks during development.
CD100 has been implicated in various diseases and conditions. In the context of cancer, CD100 expression is often upregulated in tumor cells, and it has been associated with tumor progression and metastasis. Targeting CD100 or its receptor, Plexin-B1, has been explored as a potential therapeutic strategy for cancer treatment.
In autoimmune diseases, CD100 plays a role in regulating immune responses. Dysregulation of CD100 expression or function can contribute to the pathogenesis of autoimmune conditions such as multiple sclerosis and rheumatoid arthritis. Therapeutic interventions targeting CD100 are being investigated for their potential to modulate immune responses in these diseases.
Recombinant CD100 produced in HEK cells is widely used in research to study its biological functions and interactions. It is also utilized in the development of therapeutic agents targeting CD100 or its receptor. The high purity and activity of recombinant CD100 make it a valuable tool for investigating its role in various physiological and pathological processes.
