AIF1 Human

Allograft Inflammatory Factor 1 Human Recombinant

Cat. No.

BT8873

Source

E. Coli.

Synonyms

AIF-1, Allograft inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1.

Appearance

Filtered White lyophilized (freeze-dried) powder.

Purity

Greater than 90% as determined by SDS PAGE.

Usage

THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Shipped with Ice Packs

In Stock

Quick Inquiry

Description

The AIF1 Human Recombinant contains a total of 155 amino acids having a molecular Mass of 17.7kDa. The Human AIF1 is fused to a 9 amino acid long N-terminal His tag.

Product Specs

Introduction

Human AIF1 protein exhibits a 98% homology/identity with its rat counterpart. Its expression is observed in macrophages and neutrophils, with upregulation of AIF1 transcripts induced by IFN-γ in rat macrophages. Notably, AIF1 expression is specific to human macrophage-like cell lines and a subset of CD68(+) macrophages situated within the interstitial and perivascular spaces of human heart allografts. In the context of quiescent cultured human vascular smooth muscle cells (VSMCs), AIF1 synthesis is triggered by IFN-γ, IL1b, and conditioned medium derived from T-cells. Interestingly, overexpression of AIF1 in human VSMCs leads to enhanced cellular growth. AIF1 expression is also observed during apoptosis in rat mammary gland and ventral prostate tissues. Additionally, Allograft Inflammatory Factor 1 is expressed by various tumor-associated activated macrophages and microglial cells in both rat and human gliomas, suggesting a correlation between AIF1-expressing activated macrophages and microglial cells and tumor malignancy in humans.

Description

Recombinant Human AIF1 comprises 155 amino acids, resulting in a molecular weight of 17.7kDa. It is engineered with a 9 amino acid N-terminal His tag.

Physical Appearance

White lyophilized powder that has undergone filtration.

Formulation

The product is sterile filtered and provided as a lyophilized powder from a 0.5mg/ml solution in 20mM Tris buffer (pH 7.5) containing 50mM NaCl.

Solubility

To reconstitute, add deionized water to the lyophilized pellet and allow it to dissolve completely.

Stability

For long-term storage, store lyophilized AIF1 at -20°C. After reconstitution, aliquot the protein to minimize freeze-thaw cycles. Reconstituted AIF1 can be stored at 4°C for a limited period; it remains stable for up to two weeks at this temperature. The lyophilized protein retains its stability for 24 months when stored at -20°C.

Purity

The purity of AIF1 is determined to be greater than 90% using SDS-PAGE analysis.

Synonyms

AIF-1, Allograft inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1.

Source

E. Coli.

Amino Acid Sequence

MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP.

Product Science Overview

Introduction

Allograft Inflammatory Factor 1 (AIF1), also known as Ionized calcium-binding adaptor molecule 1 (Iba1), is a calcium-binding protein that plays a crucial role in the immune response. It is predominantly expressed in activated macrophages and microglia, which are key players in the body’s defense mechanism against pathogens and in the regulation of inflammation.

Structure and Function

AIF1 is a 17-kDa protein that contains a pair of EF-hand calcium-binding motifs. These motifs are essential for its ability to bind calcium ions, which is critical for its function in various cellular processes. The protein is involved in intracellular signaling pathways that regulate phagocytosis, membrane ruffling, and F-actin polymerization. These processes are vital for the immune cells to engulf and destroy pathogens, as well as to migrate to sites of infection or injury.

Role in Inflammatory Diseases

AIF1 has been implicated in a variety of inflammatory diseases. Its expression is upregulated in tissues undergoing inflammation, and it is associated with the activation of macrophages. This protein has been linked to several diseases, including:

Kidney Disease: AIF1 is involved in the inflammatory response in kidney tissues, contributing to the progression of kidney disease.
Rheumatoid Arthritis: The protein is found in higher levels in the synovial tissues of patients with rheumatoid arthritis, indicating its role in the chronic inflammation characteristic of this disease.
Cancer: AIF1 is expressed in tumor-associated macrophages, which are known to promote tumor growth and metastasis.
Cardiovascular Diseases: The protein is involved in the inflammatory processes that contribute to atherosclerosis and other cardiovascular conditions.
Neurological Disorders: AIF1 is expressed in microglia, the resident immune cells of the central nervous system, and is involved in the inflammatory response in various neurological disorders.

Recombinant AIF1

Recombinant AIF1 is produced using recombinant DNA technology, which involves inserting the gene encoding AIF1 into a suitable expression system, such as bacteria or yeast. This allows for the large-scale production of the protein for research and therapeutic purposes. Recombinant AIF1 is used in various studies to understand its role in inflammation and to develop potential therapeutic interventions for inflammatory diseases.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Product Name

Quantity&Size*

Message

AIF1 Human

Description

Product Specs

Product Science Overview

Quick Inquiry

Category

Service